F243792

General Info

Members Datasets Scaffolds Average Seq Length
164 127 328 155

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10292916|Ga0105247_102929162
Length 166
Sequence MTFRITGLSPEPFRHLFGLPDEELRRLGARRYVVDAKPGFPDRIEVRDAEPGETVLLVNHTHQPADNPYRASHAIFVREGADSPCDVVDEVPEVMRRRLLSLRAFDGDDLMIDADVVDGERAEEMIGRLFEDPRVAYIHAHYAKRGCYAARIDRASAPTTPTATVR

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
85 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
86 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
87 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
88 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
89 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
90 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
112 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
116 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
117 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
118 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
119 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
120 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2643221646 Pelomonas sp. Root1237 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 0
Rhizoplane 8.54
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10292916 3300009101 Bacteria 1126
2 rootH1_10031758 3300003316 Bacteria 3996
3 rootH2_10133308 3300003320 Bacteria 1000
4 rootL2_10033405 3300003322 Bacteria 5211
5 rootH1_10021990 3300003323 Bacteria 3895
6 rootH1_10074874 3300003323 Bacteria 5129
7 rootH1_10352448 3300003323 Bacteria 1130
8 Ga0055530_10084547 3300003791 Bacteria 660
9 Ga0055531_10000001 3300003794 Bacteria 543586
10 Ga0070658_10000001 3300005327 Bacteria 856789
11 Ga0070658_10434759 3300005327 Bacteria 1130
12 Ga0070658_10582024 3300005327 Bacteria 970
13 Ga0068869_100160007 3300005334 Bacteria 1752
14 Ga0070682_100046716 3300005337 Bacteria 2688
15 Ga0070660_100227607 3300005339 Bacteria 1517
16 Ga0070689_100070707 3300005340 Bacteria 2725
17 Ga0070692_10116419 3300005345 Bacteria 1485
18 Ga0070688_100067005 3300005365 Bacteria 2286
19 Ga0070659_100034967 3300005366 Bacteria 3911
20 Ga0070659_100037289 3300005366 Bacteria 3789
21 Ga0070667_100014639 3300005367 Bacteria 6482
22 Ga0070714_100339369 3300005435 Bacteria 1409
23 Ga0070701_10032768 3300005438 Bacteria 2590
24 Ga0070705_100162534 3300005440 Bacteria 1494
25 Ga0070663_100022342 3300005455 Bacteria 4228
26 Ga0070678_100095005 3300005456 Bacteria 2296
27 Ga0068867_100000997 3300005459 Bacteria 19306
28 Ga0068853_101572103 3300005539 Bacteria 637
29 Ga0070686_100124189 3300005544 Bacteria 1776
30 Ga0070695_100734858 3300005545 Bacteria 786
31 Ga0070665_100021120 3300005548 Bacteria 6545
32 Ga0070702_100217754 3300005615 Bacteria 1275
33 Ga0068859_100045287 3300005617 Bacteria 4420
34 Ga0068859_100138914 3300005617 Bacteria 2503
35 Ga0068864_101574626 3300005618 Unclassified 661
36 Ga0068863_100034605 3300005841 Bacteria 4810
37 Ga0068863_100831132 3300005841 Bacteria 922
38 Ga0068858_100007059 3300005842 Bacteria 10903
39 Ga0068860_100008036 3300005843 Bacteria 10519
40 Ga0068860_100078929 3300005843 Bacteria 3130
41 Ga0068862_100003002 3300005844 Bacteria 14721
42 Ga0068862_100258592 3300005844 Bacteria 1589
43 Ga0068862_100525272 3300005844 Bacteria 1127
44 Ga0068862_102069858 3300005844 Unclassified 580
45 Ga0081455_10132780 3300005937 Bacteria 1944
46 Ga0075367_10128542 3300006178 Bacteria 1565
47 Ga0075431_101431053 3300006847 Unclassified 650
48 Ga0097620_100045289 3300006931 Bacteria 4420
49 Ga0097620_100138907 3300006931 Bacteria 2503
50 Ga0105240_10665452 3300009093 Unclassified 1140
51 Ga0105242_10460855 3300009176 Unclassified 1200
52 Ga0105248_10003815 3300009177 Bacteria 16714
53 Ga0105238_10232679 3300009551 Bacteria 1819
54 Ga0105249_10155888 3300009553 Bacteria 2202
55 Ga0105249_10529482 3300009553 Unclassified 1227
56 Ga0157373_10565616 3300013100 Bacteria 825
57 Ga0157369_10003259 3300013105 Bacteria 19324
58 Ga0157378_10035218 3300013297 Bacteria 4427
59 Ga0163163_10450606 3300014325 Bacteria 1347
60 Ga0157379_10004683 3300014968 Bacteria 11737
61 Ga0157376_10616043 3300014969 Bacteria 1082
62 Ga0213876_10006447 3300021384 Bacteria 6396
63 Ga0209050_1004169 3300025298 Bacteria 10009
64 Ga0209257_1000033 3300025304 Bacteria 671006
65 Ga0209257_1082587 3300025304 Bacteria 821
66 Ga0207710_10186267 3300025900 Bacteria 1020
67 Ga0207705_10000002 3300025909 Bacteria 2046852
68 Ga0207705_10228870 3300025909 Bacteria 1413
69 Ga0207705_10262786 3300025909 Bacteria 1318
70 Ga0207657_10008443 3300025919 Bacteria 10448
71 Ga0207681_10599463 3300025923 Bacteria 910
72 Ga0207690_10007671 3300025932 Bacteria 6401
73 Ga0207690_10020865 3300025932 Bacteria 4055
74 Ga0207686_10519360 3300025934 Bacteria 927
75 Ga0207670_10223279 3300025936 Bacteria 1443
76 Ga0207691_10122439 3300025940 Bacteria 2304
77 Ga0207711_10104012 3300025941 Bacteria 2515
78 Ga0207689_10434992 3300025942 Bacteria 1096
79 Ga0207689_11058572 3300025942 Unclassified 684
80 Ga0207712_10154310 3300025961 Bacteria 1777
81 Ga0207712_10416270 3300025961 Unclassified 1133
82 Ga0207658_10026918 3300025986 Bacteria 4036
83 Ga0207703_10003272 3300026035 Bacteria 13591
84 Ga0207639_12101575 3300026041 Unclassified 526
85 Ga0207678_10232128 3300026067 Bacteria 1580
86 Ga0207702_10188424 3300026078 Bacteria 1904
87 Ga0207641_10055658 3300026088 Bacteria 3359
88 Ga0207648_10022418 3300026089 Bacteria 5670
89 Ga0207683_11976579 3300026121 Bacteria 532
90 Ga0207698_12084006 3300026142 Bacteria 581
91 Ga0268266_10054285 3300028379 Bacteria 3443
92 Ga0268265_10004060 3300028380 Bacteria 10292
93 Ga0268265_10313706 3300028380 Bacteria 1417
94 Ga0268265_10424553 3300028380 Bacteria 1235
95 Ga0268265_11396725 3300028380 Unclassified 702
96 Ga0268264_10023969 3300028381 Bacteria 4979
97 Ga0268264_10815111 3300028381 Bacteria 933
98 Ga0307412_11802595 3300031911 Unclassified 563
99 Ga0395899_0004729 3300037312 Bacteria 10623
100 Ga0395899_0145133 3300037312 Bacteria 1686
101 Ga0395900_0002836 3300037418 Bacteria 18919
102 Ga0395900_0035482 3300037418 Bacteria 5136
103 Ga0395900_0935462 3300037418 Bacteria 789
104 Ga0395898_0005211 3300037466 Bacteria 14052
105 Ga0395898_0013682 3300037466 Bacteria 8345
106 Ga0395905_0000078 3300037471 Bacteria 161593
107 Ga0395905_0002201 3300037471 Bacteria 22018
108 Ga0395905_0006089 3300037471 Bacteria 12188
109 Ga0395905_0026995 3300037471 Bacteria 5414
110 Ga0395905_0064165 3300037471 Bacteria 3436
111 Ga0395905_0078504 3300037471 Bacteria 3094
112 Ga0395901_0135780 3300038443 Bacteria 2585
113 Ga0395901_0222825 3300038443 Bacteria 1971
114 Ga0436365_1104251 3300039437 Bacteria 95104
115 Ga0436365_1936346 3300039437 Bacteria 2169
116 Ga0436360_0950881 3300039438 Unclassified 560
117 Ga0436363_1579689 3300039450 Bacteria 691
118 Ga0450917_003397 3300042120 Bacteria 1152
119 Ga0450888_000177 3300042126 Bacteria 5576
120 Ga0450890_000922 3300042127 Bacteria 4247
121 Ga0450891_000060 3300042129 Bacteria 8748
122 Ga0450892_000623 3300042130 Bacteria 4002
123 Ga0450903_039286 3300042138 Bacteria 702
124 Ga0450893_0002656 3300042532 Bacteria 2795
125 Ga0466969_0274610 3300044656 Bacteria 763
126 Ga0466965_0737531 3300044683 Bacteria 567
127 Ga0466966_0100316 3300044684 Bacteria 1791
128 Ga0466970_0956245 3300044765 Bacteria 505
129 Ga0466960_0546601 3300044901 Bacteria 683
130 Ga0451576_0122716 3300045051 Bacteria 2705
131 Ga0466967_0258079 3300045976 Bacteria 1667
132 Ga0495628_0724980 3300046516 Unclassified 700
133 Ga0496100_0007802 3300048903 Bacteria 5937
134 Ga0496101_0021226 3300048904 Bacteria 4459
135 Ga0496102_0053010 3300048905 Bacteria 3697
136 Ga0496102_0513247 3300048905 Bacteria 1121
137 Ga0496102_1766794 3300048905 Bacteria 536
138 Ga0496103_0025745 3300048906 Bacteria 3558
139 Ga0496104_0247957 3300048907 Bacteria 1694
140 Ga0496105_0153133 3300048908 Bacteria 1895
141 Ga0496106_0001235 3300048909 Bacteria 19128
142 Ga0496110_0089738 3300048913 Bacteria 2748
143 Ga0496112_0606567 3300048915 Bacteria 1026
144 Ga0496114_0059863 3300048917 Bacteria 3182
145 Ga0496115_0118466 3300048918 Bacteria 2178
146 Ga0496115_0479262 3300048918 Bacteria 1002
147 Ga0496126_0329798 3300048929 Bacteria 1253
148 Ga0501291_099475 3300049514 Bacteria 605
149 Ga0501300_054817 3300049523 Bacteria 621
150 Ga0501073_0898004 3300049589 Unclassified 610
151 Ga0501077_0174408 3300049593 Unclassified 1366
152 Ga0501222_010349 3300049662 Bacteria 1233
153 Ga0501233_056122 3300049668 Bacteria 966
154 Ga0501235_008143 3300049669 Bacteria 2287
155 Ga0501258_023370 3300049687 Bacteria 740
156 Ga0501221_013452 3300049704 Bacteria 1505
157 Ga0501229_000935 3300049706 Bacteria 3301
158 Ga0501080_0012684 3300049742 Bacteria 7729
159 Ga0501083_0010491 3300049744 Bacteria 6519
160 nmdc:mga06z11_671862_c1 3300050494 Unclassified 631
161 Ga0500590_138543 3300053148 Bacteria 1115
162 Ga0501082_0028776 3300060353 Bacteria 4786
163 Ga0466962_0272884 3300061719 Bacteria 834
164 2644260278 2643221646 Bacteria 6433402
165 Ga0105247_10292916
166 rootH1_10031758
167 rootH2_10133308
168 rootL2_10033405
169 rootH1_10021990
170 rootH1_10074874
171 rootH1_10352448
172 Ga0055530_10084547
173 Ga0055531_10000001
174 Ga0070658_10000001
175 Ga0070658_10434759
176 Ga0070658_10582024
177 Ga0068869_100160007
178 Ga0070682_100046716
179 Ga0070660_100227607
180 Ga0070689_100070707
181 Ga0070692_10116419
182 Ga0070688_100067005
183 Ga0070659_100034967
184 Ga0070659_100037289
185 Ga0070667_100014639
186 Ga0070714_100339369
187 Ga0070701_10032768
188 Ga0070705_100162534
189 Ga0070663_100022342
190 Ga0070678_100095005
191 Ga0068867_100000997
192 Ga0068853_101572103
193 Ga0070686_100124189
194 Ga0070695_100734858
195 Ga0070665_100021120
196 Ga0070702_100217754
197 Ga0068859_100045287
198 Ga0068859_100138914
199 Ga0068864_101574626
200 Ga0068863_100034605
201 Ga0068863_100831132
202 Ga0068858_100007059
203 Ga0068860_100008036
204 Ga0068860_100078929
205 Ga0068862_100003002
206 Ga0068862_100258592
207 Ga0068862_100525272
208 Ga0068862_102069858
209 Ga0081455_10132780
210 Ga0075367_10128542
211 Ga0075431_101431053
212 Ga0097620_100045289
213 Ga0097620_100138907
214 Ga0105240_10665452
215 Ga0105242_10460855
216 Ga0105248_10003815
217 Ga0105238_10232679
218 Ga0105249_10155888
219 Ga0105249_10529482
220 Ga0157373_10565616
221 Ga0157369_10003259
222 Ga0157378_10035218
223 Ga0163163_10450606
224 Ga0157379_10004683
225 Ga0157376_10616043
226 Ga0213876_10006447
227 Ga0209050_1004169
228 Ga0209257_1000033
229 Ga0209257_1082587
230 Ga0207710_10186267
231 Ga0207705_10000002
232 Ga0207705_10228870
233 Ga0207705_10262786
234 Ga0207657_10008443
235 Ga0207681_10599463
236 Ga0207690_10007671
237 Ga0207690_10020865
238 Ga0207686_10519360
239 Ga0207670_10223279
240 Ga0207691_10122439
241 Ga0207711_10104012
242 Ga0207689_10434992
243 Ga0207689_11058572
244 Ga0207712_10154310
245 Ga0207712_10416270
246 Ga0207658_10026918
247 Ga0207703_10003272
248 Ga0207639_12101575
249 Ga0207678_10232128
250 Ga0207702_10188424
251 Ga0207641_10055658
252 Ga0207648_10022418
253 Ga0207683_11976579
254 Ga0207698_12084006
255 Ga0268266_10054285
256 Ga0268265_10004060
257 Ga0268265_10313706
258 Ga0268265_10424553
259 Ga0268265_11396725
260 Ga0268264_10023969
261 Ga0268264_10815111
262 Ga0307412_11802595
263 Ga0395899_0004729
264 Ga0395899_0145133
265 Ga0395900_0002836
266 Ga0395900_0035482
267 Ga0395900_0935462
268 Ga0395898_0005211
269 Ga0395898_0013682
270 Ga0395905_0000078
271 Ga0395905_0002201
272 Ga0395905_0006089
273 Ga0395905_0026995
274 Ga0395905_0064165
275 Ga0395905_0078504
276 Ga0395901_0135780
277 Ga0395901_0222825
278 Ga0436365_1104251
279 Ga0436365_1936346
280 Ga0436360_0950881
281 Ga0436363_1579689
282 Ga0450917_003397
283 Ga0450888_000177
284 Ga0450890_000922
285 Ga0450891_000060
286 Ga0450892_000623
287 Ga0450903_039286
288 Ga0450893_0002656
289 Ga0466969_0274610
290 Ga0466965_0737531
291 Ga0466966_0100316
292 Ga0466970_0956245
293 Ga0466960_0546601
294 Ga0451576_0122716
295 Ga0466967_0258079
296 Ga0495628_0724980
297 Ga0496100_0007802
298 Ga0496101_0021226
299 Ga0496102_0053010
300 Ga0496102_0513247
301 Ga0496102_1766794
302 Ga0496103_0025745
303 Ga0496104_0247957
304 Ga0496105_0153133
305 Ga0496106_0001235
306 Ga0496110_0089738
307 Ga0496112_0606567
308 Ga0496114_0059863
309 Ga0496115_0118466
310 Ga0496115_0479262
311 Ga0496126_0329798
312 Ga0501291_099475
313 Ga0501300_054817
314 Ga0501073_0898004
315 Ga0501077_0174408
316 Ga0501222_010349
317 Ga0501233_056122
318 Ga0501235_008143
319 Ga0501258_023370
320 Ga0501221_013452
321 Ga0501229_000935
322 Ga0501080_0012684
323 Ga0501083_0010491
324 nmdc:mga06z11_671862_c1
325 Ga0500590_138543
326 Ga0501082_0028776
327 Ga0466962_0272884
328 2644260278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06718

DUF1203

Protein of unknown function (DUF1203)

39

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nqh-assembly1.cif.gz_A crystal structure of a glycosyl hydrolase (bt_2959) from bacteroides thetaiotaomicron vpi-5482 at 2.11 a resolution 0.7152 92 116
1yd6-assembly1.cif.gz_B crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from bacillus caldotenax 0.663 90 140
1yd6-assembly1.cif.gz_D crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from bacillus caldotenax 0.6396 90 143
3h25-assembly1.cif.gz_A crystal structure of the catalytic domain of primase repb' in complex with initiator dna 0.6247 90 142
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.6002 95 152
ID Description Score Start End Superfamily
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8478 134 149 3.10.129.10
af_Q940V5_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6938 134 150 3.10.129.10
af_Q57743_81_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.6913 96 128 3.40.140.10
af_P9WFC5_7_103_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6862 87 140 3.40.1440.10
af_Q2FZD0_4_102_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6717 90 140 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A4Q5SRD7-F1-model_v4 DUF1203 domain-containing protein 0.9902 86 152
AF-A0A1W7M8C9-F1-model_v4 DUF1203 domain-containing protein 0.9745 82 152
AF-A0A537AGN1-F1-model_v4 DUF1203 domain-containing protein 0.9706 89 152
AF-A0A0J8RKR9-F1-model_v4 DUF1203 domain-containing protein 0.9705 86 152
AF-A0A545TG16-F1-model_v4 DUF1203 domain-containing protein 0.9661 86 152

Map