F244352

General Info

Members Datasets Scaffolds Average Seq Length
164 131 328 138

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0951073|Ga0395898_0951073_30_518
Length 162
Sequence MGACGKRAVSAYETDLDLPPEGGKPMPSTDRKIPQRLYHGTRADLKPGDLIATGYRSNFGTGKPLSWVYCTGTLDAAIWGAELAAGSGRGRIYIVEPTGGLIDDPNLIDKKFPGNPTQSYRSREPLRVIGEVTEWQGHAPERLQQMKENVERLRKEGAEIID

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
115 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
116 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
117 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
118 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
119 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
120 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
121 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
122 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 2842711865 Duganella sp. R-73148 Isolate Unclassified
131 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.83
Nodule 1.22
Rhizoplane 2.44
Rhizosphere 60.37
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0951073 3300037466 Bacteria 796
2 JGI25151J46595_10000015 3300003187 Bacteria 250420
3 JGI25151J46595_10003418 3300003187 Bacteria 8785
4 JGI25153J46596_10000069 3300003215 Bacteria 117156
5 rootL2_10145671 3300003322 Unclassified 2351
6 Ga0055539_1003883 3300003752 Bacteria 2030
7 Ga0055526_1000700 3300003771 Bacteria 25408
8 Ga0055524_1000051 3300003775 Bacteria 146215
9 Ga0055531_10000044 3300003794 Bacteria 133446
10 Ga0055531_10033722 3300003794 Bacteria 1641
11 Ga0065165_1038393 3300005262 Bacteria 1444
12 Ga0065165_1059187 3300005262 Bacteria 1055
13 Ga0070683_100493140 3300005329 Bacteria 1170
14 Ga0070666_10069359 3300005335 Bacteria 2397
15 Ga0070680_100134986 3300005336 Bacteria 2066
16 Ga0070660_100576408 3300005339 Unclassified 940
17 Ga0070661_101009173 3300005344 Unclassified 690
18 Ga0070668_101190479 3300005347 Bacteria 690
19 Ga0070659_100123499 3300005366 Bacteria 2099
20 Ga0070681_10208653 3300005458 Unclassified 1870
21 Ga0070679_100008787 3300005530 Bacteria 9527
22 Ga0070684_101334819 3300005535 Unclassified 675
23 Ga0068853_100002034 3300005539 Bacteria 14977
24 Ga0068853_100002626 3300005539 Bacteria 13527
25 Ga0068853_100041194 3300005539 Bacteria 3943
26 Ga0070665_100000067 3300005548 Bacteria 204787
27 Ga0070665_100000177 3300005548 Bacteria 113201
28 Ga0070665_101206561 3300005548 Bacteria 767
29 Ga0068854_100458417 3300005578 Bacteria 1066
30 Ga0068856_101179725 3300005614 Bacteria 782
31 Ga0075367_10255286 3300006178 Bacteria 1100
32 Ga0075431_101159301 3300006847 Bacteria 736
33 Ga0099826_10000010 3300006948 Bacteria 314346
34 Ga0105240_10040001 3300009093 Bacteria 6002
35 Ga0105240_10300545 3300009093 Bacteria 1836
36 Ga0105245_10708865 3300009098 Bacteria 1040
37 Ga0105241_10012445 3300009174 Bacteria 6236
38 Ga0105248_11335787 3300009177 Bacteria 811
39 Ga0105237_10016707 3300009545 Bacteria 7619
40 Ga0105237_10091547 3300009545 Bacteria 3030
41 Ga0105237_10133176 3300009545 Bacteria 2480
42 Ga0105237_10539738 3300009545 Bacteria 1173
43 Ga0105238_10332689 3300009551 Bacteria 1506
44 Ga0105239_10120781 3300010375 Bacteria 2910
45 Ga0105239_10241273 3300010375 Bacteria 2028
46 Ga0105239_10339734 3300010375 Unclassified 1694
47 Ga0157369_11170363 3300013105 Bacteria 785
48 Ga0157372_11815698 3300013307 Bacteria 701
49 Ga0157376_11509700 3300014969 Bacteria 705
50 Ga0163161_10221064 3300017792 Bacteria 1467
51 Ga0209677_101629 3300025253 Bacteria 9462
52 Ga0209129_1000019 3300025258 Bacteria 460802
53 Ga0209675_1000378 3300025291 Bacteria 37093
54 Ga0209025_1000010 3300025294 Bacteria 986612
55 Ga0209025_1000309 3300025294 Bacteria 108378
56 Ga0209564_1000048 3300025295 Bacteria 364806
57 Ga0209564_1019686 3300025295 Bacteria 2511
58 Ga0209758_1000005 3300025297 Bacteria 1368918
59 Ga0209050_1006766 3300025298 Bacteria 6686
60 Ga0209256_1000041 3300025299 Bacteria 364827
61 Ga0209051_1037239 3300025303 Bacteria 1787
62 Ga0209051_1037342 3300025303 Bacteria 1782
63 Ga0209257_1000094 3300025304 Bacteria 262243
64 Ga0209257_1000303 3300025304 Bacteria 107862
65 Ga0209257_1063619 3300025304 Bacteria 995
66 Ga0207680_10519872 3300025903 Bacteria 848
67 Ga0207647_10025851 3300025904 Bacteria 3849
68 Ga0207705_10221818 3300025909 Unclassified 1436
69 Ga0207654_10363604 3300025911 Bacteria 999
70 Ga0207707_10224279 3300025912 Bacteria 1636
71 Ga0207695_10061740 3300025913 Bacteria 3872
72 Ga0207695_10240310 3300025913 Bacteria 1712
73 Ga0207671_10043828 3300025914 Bacteria 3308
74 Ga0207671_10061198 3300025914 Bacteria 2793
75 Ga0207660_10019600 3300025917 Bacteria 4524
76 Ga0207657_10498507 3300025919 Unclassified 954
77 Ga0207652_10138014 3300025921 Unclassified 2178
78 Ga0207694_10239149 3300025924 Bacteria 1484
79 Ga0207687_11283369 3300025927 Bacteria 629
80 Ga0207661_10454555 3300025944 Bacteria 1167
81 Ga0207640_10637332 3300025981 Bacteria 906
82 Ga0207658_10150688 3300025986 Bacteria 1894
83 Ga0207639_10001428 3300026041 Bacteria 16145
84 Ga0207639_10002068 3300026041 Bacteria 13533
85 Ga0207639_10038697 3300026041 Bacteria 3549
86 Ga0207678_10303820 3300026067 Bacteria 1371
87 Ga0209282_1000009 3300027666 Bacteria 233366
88 Ga0268266_10000002 3300028379 Bacteria 3059047
89 Ga0268266_10001309 3300028379 Bacteria 30237
90 Ga0307517_10248690 3300028786 Bacteria 1046
91 Ga0307515_10856967 3300028794 Bacteria 536
92 Ga0307508_10430656 3300031616 Bacteria 911
93 Ga0307413_10762247 3300031824 Bacteria 810
94 Ga0307407_10648480 3300031903 Bacteria 791
95 Ga0307409_100096527 3300031995 Bacteria 2439
96 Ga0373926_0282075 3300035083 Bacteria 647
97 Ga0436361_0187658 3300039447 Bacteria 5077
98 Ga0439461_0041869 3300041410 Bacteria 992
99 Ga0451853_3085233 3300041512 Bacteria 757
100 Ga0450898_020142 3300042134 Bacteria 1167
101 Ga0495638_0448692 3300046460 Bacteria 659
102 Ga0495606_0077910 3300046507 Bacteria 2068
103 Ga0495616_0000014 3300046513 Bacteria 191010
104 Ga0495620_0083673 3300046515 Bacteria 1288
105 Ga0495628_0641325 3300046516 Bacteria 755
106 Ga0495643_0165744 3300046522 Bacteria 1084
107 Ga0495648_0028398 3300046524 Bacteria 3727
108 Ga0495597_0398326 3300046542 Bacteria 524
109 Ga0495668_0026528 3300046616 Bacteria 3287
110 Ga0495668_0433199 3300046616 Bacteria 723
111 Ga0495625_0000078 3300046660 Bacteria 161613
112 Ga0495625_0133825 3300046660 Bacteria 1677
113 Ga0495625_0344290 3300046660 Bacteria 944
114 Ga0495646_0283435 3300046680 Bacteria 880
115 Ga0495658_0021264 3300046683 Bacteria 3419
116 Ga0495649_0241296 3300046694 Bacteria 930
117 Ga0495687_000353 3300047443 Bacteria 58833
118 Ga0495686_0243795 3300047472 Bacteria 1012
119 Ga0496103_0005622 3300048906 Bacteria 7493
120 Ga0496105_0569421 3300048908 Bacteria 882
121 Ga0496107_1313565 3300048910 Bacteria 517
122 Ga0496115_0056649 3300048918 Bacteria 3151
123 Ga0496116_0012146 3300048919 Bacteria 7051
124 Ga0496117_0012446 3300048920 Bacteria 7493
125 Ga0496118_0014117 3300048921 Bacteria 7493
126 Ga0496119_0032313 3300048922 Bacteria 3490
127 Ga0496122_0532039 3300048925 Bacteria 564
128 Ga0496124_0014886 3300048927 Bacteria 7493
129 Ga0496126_0087153 3300048929 Bacteria 2751
130 Ga0496126_1104052 3300048929 Bacteria 589
131 Ga0501034_1268951 3300049571 Bacteria 614
132 Ga0501043_0246424 3300049579 Bacteria 1377
133 Ga0501043_0404274 3300049579 Bacteria 1031
134 Ga0501047_0258361 3300049581 Bacteria 1590
135 Ga0501047_0284797 3300049581 Bacteria 1497
136 Ga0501073_0073367 3300049589 Bacteria 2383
137 Ga0501080_0772291 3300049742 Bacteria 844
138 Ga0501083_0110252 3300049744 Bacteria 1810
139 Ga0501044_0096200 3300049823 Bacteria 2983
140 Ga0501044_0231361 3300049823 Bacteria 1796
141 Ga0501044_0449486 3300049823 Bacteria 1195
142 nmdc:mga06z11_221549_c1 3300050494 Bacteria 1106
143 nmdc:mga06r32_1048472_c1 3300050510 Bacteria 766
144 Ga0500635_0174643 3300053080 Bacteria 828
145 Ga0495655_0022308 3300053083 Bacteria 1445
146 Ga0500578_0132183 3300053086 Bacteria 1564
147 Ga0500643_011124 3300053087 Bacteria 3303
148 Ga0500651_0012890 3300053093 Bacteria 5077
149 Ga0500651_0141014 3300053093 Bacteria 1453
150 Ga0500640_090004 3300053095 Bacteria 1287
151 Ga0500595_000526 3300053119 Bacteria 23061
152 Ga0500595_060931 3300053119 Bacteria 1140
153 Ga0500607_038284 3300053121 Bacteria 2610
154 Ga0500608_274084 3300053122 Bacteria 643
155 Ga0500658_0474362 3300053134 Bacteria 568
156 Ga0500588_0008023 3300053146 Bacteria 2451
157 Ga0500604_0065544 3300053151 Bacteria 1149
158 Ga0500616_0001791 3300053153 Bacteria 19569
159 Ga0500638_064224 3300053162 Bacteria 1760
160 Ga0500636_0003003 3300053177 Bacteria 9450
161 Ga0500625_171087 3300053729 Bacteria 779
162 Ga0501084_0471063 3300054114 Bacteria 1062
163 2842713532 2842711865 Bacteria 7155354
164 2888392586 2888388044 Bacteria 7304136
165 Ga0395898_0951073
166 JGI25151J46595_10000015
167 JGI25151J46595_10003418
168 JGI25153J46596_10000069
169 rootL2_10145671
170 Ga0055539_1003883
171 Ga0055526_1000700
172 Ga0055524_1000051
173 Ga0055531_10000044
174 Ga0055531_10033722
175 Ga0065165_1038393
176 Ga0065165_1059187
177 Ga0070683_100493140
178 Ga0070666_10069359
179 Ga0070680_100134986
180 Ga0070660_100576408
181 Ga0070661_101009173
182 Ga0070668_101190479
183 Ga0070659_100123499
184 Ga0070681_10208653
185 Ga0070679_100008787
186 Ga0070684_101334819
187 Ga0068853_100002034
188 Ga0068853_100002626
189 Ga0068853_100041194
190 Ga0070665_100000067
191 Ga0070665_100000177
192 Ga0070665_101206561
193 Ga0068854_100458417
194 Ga0068856_101179725
195 Ga0075367_10255286
196 Ga0075431_101159301
197 Ga0099826_10000010
198 Ga0105240_10040001
199 Ga0105240_10300545
200 Ga0105245_10708865
201 Ga0105241_10012445
202 Ga0105248_11335787
203 Ga0105237_10016707
204 Ga0105237_10091547
205 Ga0105237_10133176
206 Ga0105237_10539738
207 Ga0105238_10332689
208 Ga0105239_10120781
209 Ga0105239_10241273
210 Ga0105239_10339734
211 Ga0157369_11170363
212 Ga0157372_11815698
213 Ga0157376_11509700
214 Ga0163161_10221064
215 Ga0209677_101629
216 Ga0209129_1000019
217 Ga0209675_1000378
218 Ga0209025_1000010
219 Ga0209025_1000309
220 Ga0209564_1000048
221 Ga0209564_1019686
222 Ga0209758_1000005
223 Ga0209050_1006766
224 Ga0209256_1000041
225 Ga0209051_1037239
226 Ga0209051_1037342
227 Ga0209257_1000094
228 Ga0209257_1000303
229 Ga0209257_1063619
230 Ga0207680_10519872
231 Ga0207647_10025851
232 Ga0207705_10221818
233 Ga0207654_10363604
234 Ga0207707_10224279
235 Ga0207695_10061740
236 Ga0207695_10240310
237 Ga0207671_10043828
238 Ga0207671_10061198
239 Ga0207660_10019600
240 Ga0207657_10498507
241 Ga0207652_10138014
242 Ga0207694_10239149
243 Ga0207687_11283369
244 Ga0207661_10454555
245 Ga0207640_10637332
246 Ga0207658_10150688
247 Ga0207639_10001428
248 Ga0207639_10002068
249 Ga0207639_10038697
250 Ga0207678_10303820
251 Ga0209282_1000009
252 Ga0268266_10000002
253 Ga0268266_10001309
254 Ga0307517_10248690
255 Ga0307515_10856967
256 Ga0307508_10430656
257 Ga0307413_10762247
258 Ga0307407_10648480
259 Ga0307409_100096527
260 Ga0373926_0282075
261 Ga0436361_0187658
262 Ga0439461_0041869
263 Ga0451853_3085233
264 Ga0450898_020142
265 Ga0495638_0448692
266 Ga0495606_0077910
267 Ga0495616_0000014
268 Ga0495620_0083673
269 Ga0495628_0641325
270 Ga0495643_0165744
271 Ga0495648_0028398
272 Ga0495597_0398326
273 Ga0495668_0026528
274 Ga0495668_0433199
275 Ga0495625_0000078
276 Ga0495625_0133825
277 Ga0495625_0344290
278 Ga0495646_0283435
279 Ga0495658_0021264
280 Ga0495649_0241296
281 Ga0495687_000353
282 Ga0495686_0243795
283 Ga0496103_0005622
284 Ga0496105_0569421
285 Ga0496107_1313565
286 Ga0496115_0056649
287 Ga0496116_0012146
288 Ga0496117_0012446
289 Ga0496118_0014117
290 Ga0496119_0032313
291 Ga0496122_0532039
292 Ga0496124_0014886
293 Ga0496126_0087153
294 Ga0496126_1104052
295 Ga0501034_1268951
296 Ga0501043_0246424
297 Ga0501043_0404274
298 Ga0501047_0258361
299 Ga0501047_0284797
300 Ga0501073_0073367
301 Ga0501080_0772291
302 Ga0501083_0110252
303 Ga0501044_0096200
304 Ga0501044_0231361
305 Ga0501044_0449486
306 nmdc:mga06z11_221549_c1
307 nmdc:mga06r32_1048472_c1
308 Ga0500635_0174643
309 Ga0495655_0022308
310 Ga0500578_0132183
311 Ga0500643_011124
312 Ga0500651_0012890
313 Ga0500651_0141014
314 Ga0500640_090004
315 Ga0500595_000526
316 Ga0500595_060931
317 Ga0500607_038284
318 Ga0500608_274084
319 Ga0500658_0474362
320 Ga0500588_0008023
321 Ga0500604_0065544
322 Ga0500616_0001791
323 Ga0500638_064224
324 Ga0500636_0003003
325 Ga0500625_171087
326 Ga0501084_0471063
327 2842713532
328 2888392586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12120

Arr-ms

Rifampin ADP-ribosyl transferase

37

135

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.9207 8 137
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.8701 8 137
1s5e-assembly2.cif.gz_B cholera holotoxin, crystal form 1 0.5966 11 97
2aua-assembly1.cif.gz_A structure of bc2332: a protein of unknown function from bacillus cereus 0.5871 40 110
1s5e-assembly1.cif.gz_A cholera holotoxin, crystal form 1 0.5832 11 97
ID Description Score Start End Superfamily
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.9207 8 137 3.20.170.40
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.8701 8 137 3.20.170.40
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.5967 11 110 3.20.170.10
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.5741 11 115 3.20.170.20
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.5366 11 110 3.20.170.10
ID Description Score Start End GO Terms
AF-A0A7Z0D1J8-F1-model_v4 Cation diffusion facilitator CzcD-associated flavoprotein CzcO 0.9439 10 137 GO:0004497
GO:0050660
AF-A0A366ZAM6-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.9439 12 137 GO:0016740
AF-A0A7X5C9L4-F1-model_v4 deleted 0.9406 11 137
AF-A0A136WAX5-F1-model_v4 Virginiamycin A acetyltransferase (EC 2.3.1.-) 0.9405 12 136 GO:0016746
AF-A0A2S9FLE5-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.9395 26 137 GO:0016740

Map