F244398

General Info

Members Datasets Scaffolds Average Seq Length
164 94 164 165

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1517604|Ga0436363_1517604_41_625
Length 194
Sequence VLKPLLSAGAIFTGFRNYVATVKPDPLVVDSPARVRTVRETQSEYSEFCLPNDANTLGNMLGGHVMHLVDLCGAIAAMRHARCPVVTASVDQMTFLHPVRLGELVRLRSQVNRVFRTSMEVGVKVWVENLQSGDIRHTSSAYLTFVAVDTAGNRVVLPQIVPETEEEKRRFAEAAERRSYRLAFKDKTRNRPNL

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 67.68
Stem 0
Stem Tuber 0
Unclassified 30.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_101430994 3300005364 Bacteria 651
2 Ga0070659_100609375 3300005366 Bacteria 939
3 Ga0070709_10453757 3300005434 Unclassified 966
4 Ga0070714_100218320 3300005435 Bacteria 1751
5 Ga0070714_100450383 3300005435 Unclassified 1223
6 Ga0070713_100006853 3300005436 Bacteria 7942
7 Ga0070713_100977439 3300005436 Unclassified 816
8 Ga0070711_100071183 3300005439 Unclassified 2450
9 Ga0070708_100174900 3300005445 Bacteria 2005
10 Ga0070663_100562746 3300005455 Bacteria 954
11 Ga0070678_100045230 3300005456 Bacteria 3148
12 Ga0070685_11116712 3300005466 Bacteria 596
13 Ga0070698_100000844 3300005471 Bacteria 33554
14 Ga0070699_100022461 3300005518 Bacteria 5438
15 Ga0070679_100487962 3300005530 Unclassified 1176
16 Ga0070697_100440104 3300005536 Bacteria 1134
17 Ga0068853_100071631 3300005539 Unclassified 3019
18 Ga0070695_100061261 3300005545 Bacteria 2441
19 Ga0070665_100033680 3300005548 Bacteria 5154
20 Ga0068855_100035495 3300005563 Bacteria 5939
21 Ga0068855_100115301 3300005563 Unclassified 3080
22 Ga0068855_100244539 3300005563 Bacteria 2003
23 Ga0070664_100037018 3300005564 Unclassified 4101
24 Ga0068856_100023254 3300005614 Bacteria 6026
25 Ga0068856_101087353 3300005614 Unclassified 817
26 Ga0068859_100385920 3300005617 Bacteria 1496
27 Ga0081455_10012102 3300005937 Bacteria 8623
28 Ga0070717_10066010 3300006028 Bacteria 3009
29 Ga0068871_100983540 3300006358 Bacteria 785
30 Ga0075436_100815669 3300006914 Unclassified 695
31 Ga0097620_100385955 3300006931 Bacteria 1496
32 Ga0105240_10825401 3300009093 Unclassified 1002
33 Ga0105245_10387315 3300009098 Bacteria 1393
34 Ga0105241_11491987 3300009174 Unclassified 650
35 Ga0157373_10025082 3300013100 Unclassified 4316
36 Ga0157373_10163576 3300013100 Unclassified 1566
37 Ga0157373_10190788 3300013100 Bacteria 1444
38 Ga0157371_10283277 3300013102 Bacteria 1198
39 Ga0157370_10146624 3300013104 Unclassified 2197
40 Ga0157370_10202599 3300013104 Bacteria 1841
41 Ga0157369_10000849 3300013105 Bacteria 39030
42 Ga0157369_10061844 3300013105 Bacteria 4035
43 Ga0157369_10101809 3300013105 Bacteria 3061
44 Ga0157369_10503028 3300013105 Unclassified 1254
45 Ga0157374_10005812 3300013296 Bacteria 10422
46 Ga0157374_10488511 3300013296 Bacteria 1235
47 Ga0157372_10186342 3300013307 Unclassified 2403
48 Ga0157372_10219342 3300013307 Bacteria 2205
49 Ga0157372_11074401 3300013307 Unclassified 931
50 Ga0157380_10094603 3300014326 Bacteria 2473
51 Ga0157376_10190714 3300014969 Unclassified 1879
52 Ga0213872_10002198 3300021361 Bacteria 11692
53 Ga0213874_10015728 3300021377 Bacteria 2001
54 Ga0213874_10018199 3300021377 Bacteria 1896
55 Ga0213876_10000572 3300021384 Bacteria 27400
56 Ga0213876_10010177 3300021384 Bacteria 5052
57 Ga0213876_10043642 3300021384 Bacteria 2370
58 Ga0213876_10127180 3300021384 Bacteria 1354
59 Ga0213876_10164294 3300021384 Unclassified 1181
60 Ga0213875_10000019 3300021388 Bacteria 231333
61 Ga0213875_10000566 3300021388 Bacteria 30156
62 Ga0213875_10010452 3300021388 Bacteria 4643
63 Ga0213875_10010465 3300021388 Bacteria 4640
64 Ga0213875_10016785 3300021388 Bacteria 3545
65 Ga0213875_10020748 3300021388 Bacteria 3151
66 Ga0213875_10032872 3300021388 Bacteria 2450
67 Ga0213875_10070024 3300021388 Bacteria 1637
68 Ga0213875_10283134 3300021388 Bacteria 783
69 Ga0213871_10017500 3300021441 Bacteria 1742
70 Ga0207707_10007323 3300025912 Bacteria 9612
71 Ga0207695_10492135 3300025913 Unclassified 1108
72 Ga0207663_10064107 3300025916 Unclassified 2343
73 Ga0207657_10126536 3300025919 Bacteria 2098
74 Ga0207649_10275921 3300025920 Bacteria 1220
75 Ga0207652_10392055 3300025921 Bacteria 1253
76 Ga0207687_10373691 3300025927 Bacteria 1166
77 Ga0207700_10445063 3300025928 Bacteria 1141
78 Ga0207664_10344494 3300025929 Bacteria 1318
79 Ga0207664_10398548 3300025929 Unclassified 1224
80 Ga0207690_10520826 3300025932 Bacteria 964
81 Ga0207706_10114033 3300025933 Bacteria 2377
82 Ga0207679_10054603 3300025945 Bacteria 2942
83 Ga0207667_10094817 3300025949 Unclassified 3081
84 Ga0207667_10326792 3300025949 Unclassified 1566
85 Ga0207677_10412516 3300026023 Bacteria 1148
86 Ga0207702_10036777 3300026078 Unclassified 4096
87 Ga0207702_10590463 3300026078 Unclassified 1089
88 Ga0207683_10065535 3300026121 Bacteria 3203
89 Ga0207698_10015252 3300026142 Bacteria 5144
90 Ga0268266_10238510 3300028379 Bacteria 1677
91 Ga0265340_10260489 3300031247 Bacteria 772
92 Ga0265331_10066735 3300031250 Unclassified 1689
93 Ga0265316_10017565 3300031344 Bacteria 6176
94 Ga0373923_0354963 3300035111 Unclassified 700
95 Ga0373954_0081011 3300035118 Bacteria 1551
96 Ga0373935_0299094 3300035692 Bacteria 1137
97 Ga0373927_0898305 3300035695 Unclassified 585
98 Ga0373947_0680268 3300035725 Bacteria 702
99 Ga0373937_0413218 3300036401 Unclassified 1280
100 Ga0373925_1563997 3300037068 Bacteria 539
101 Ga0395900_1465269 3300037418 Bacteria 595
102 Ga0436364_0093151 3300037853 Bacteria 54720
103 Ga0436364_0141814 3300037853 Bacteria 1230
104 Ga0436364_0210103 3300037853 Bacteria 784
105 Ga0436364_0245405 3300037853 Unclassified 3599
106 Ga0436364_0261665 3300037853 Bacteria 3025
107 Ga0436364_0262447 3300037853 Unclassified 665
108 Ga0436364_0265125 3300037853 Bacteria 12562
109 Ga0436364_0366372 3300037853 Bacteria 231753
110 Ga0436364_0417100 3300037853 Bacteria 3878
111 Ga0436364_0443936 3300037853 Unclassified 794
112 Ga0436364_0476408 3300037853 Bacteria 4651
113 Ga0436364_0627119 3300037853 Bacteria 5335
114 Ga0436364_0704313 3300037853 Unclassified 1184
115 Ga0436364_0769849 3300037853 Bacteria 1730
116 Ga0436364_0941496 3300037853 Bacteria 1793
117 Ga0436364_0959382 3300037853 Bacteria 1692
118 Ga0436364_1230770 3300037853 Bacteria 3025
119 Ga0436364_1372089 3300037853 Bacteria 5473
120 Ga0436364_1450970 3300037853 Bacteria 5177
121 Ga0436364_1528714 3300037853 Bacteria 88642
122 Ga0436365_0206992 3300039437 Bacteria 8037
123 Ga0436365_0382553 3300039437 Unclassified 788
124 Ga0436365_0972891 3300039437 Bacteria 1773
125 Ga0436365_1007960 3300039437 Bacteria 9596
126 Ga0436365_1310216 3300039437 Bacteria 8995
127 Ga0436365_1356056 3300039437 Bacteria 1600
128 Ga0436365_1374793 3300039437 Bacteria 3105
129 Ga0436365_1667551 3300039437 Unclassified 1157
130 Ga0436360_0842599 3300039438 Unclassified 903
131 Ga0436360_0913928 3300039438 Bacteria 14895
132 Ga0436360_0924594 3300039438 Bacteria 2165
133 Ga0436360_0970566 3300039438 Unclassified 1084
134 Ga0436361_0139021 3300039447 Bacteria 59763
135 Ga0436363_0124517 3300039450 Unclassified 767
136 Ga0436363_0194633 3300039450 Bacteria 2859
137 Ga0436363_0506899 3300039450 Bacteria 7020
138 Ga0436363_0691483 3300039450 Bacteria 10419
139 Ga0436363_0768308 3300039450 Unclassified 981
140 Ga0436363_1517604 3300039450 Unclassified 638
141 Ga0436362_0045582 3300039453 Bacteria 608
142 Ga0436362_0376022 3300039453 Bacteria 2122
143 Ga0436362_0614913 3300039453 Bacteria 7479
144 Ga0436362_1248524 3300039453 Unclassified 701
145 Ga0453683_0897339 3300044673 Bacteria 586
146 Ga0466966_0068158 3300044684 Bacteria 2234
147 Ga0466963_0410425 3300044694 Unclassified 955
148 Ga0453684_0555392 3300044712 Unclassified 1264
149 Ga0453684_0556377 3300044712 Bacteria 1263
150 Ga0451576_0020702 3300045051 Bacteria 7158
151 Ga0451576_0567066 3300045051 Bacteria 1193
152 Ga0451576_1449960 3300045051 Bacteria 714
153 Ga0466958_0178298 3300045836 Bacteria 1348
154 Ga0466967_0180553 3300045976 Bacteria 1991
155 Ga0495580_0135099 3300046472 Bacteria 1710
156 Ga0495639_0204763 3300046475 Unclassified 967
157 Ga0495644_0086600 3300046523 Unclassified 1181
158 Ga0495598_0072062 3300046537 Bacteria 1090
159 Ga0495669_0275152 3300046684 Bacteria 810
160 Ga0495670_0100112 3300046691 Bacteria 1492
161 Ga0495674_0565703 3300047319 Bacteria 904
162 Ga0496110_0533404 3300048913 Bacteria 1067
163 Ga0496112_0017387 3300048915 Bacteria 6754
164 Ga0496115_0034389 3300048918 Bacteria 4005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0842599 Ga0436360_0842599_147_686 138
2 3300005548 Ga0070665_100033680 Ga0070665_1000336802 139
3 3300028379 Ga0268266_10238510 Ga0268266_102385102 139
4 3300037853 Ga0436364_0704313 Ga0436364_0704313_104_634 139
5 3300039438 Ga0436360_0970566 Ga0436360_0970566_222_761 139
6 3300039450 Ga0436363_0768308 Ga0436363_0768308_166_696 139
7 3300035692 Ga0373935_0299094 Ga0373935_0299094_167_694 143
8 3300045836 Ga0466958_0178298 Ga0466958_0178298_126_659 143
9 3300021388 Ga0213875_10010452 Ga0213875_100104522 145
10 3300037853 Ga0436364_0627119 Ga0436364_0627119_3263_3796 145
11 3300013105 Ga0157369_10503028 Ga0157369_105030282 146
12 3300037853 Ga0436364_1230770 Ga0436364_1230770_200_736 146
13 3300044712 Ga0453684_0555392 Ga0453684_0555392_610_1071 147
14 3300045051 Ga0451576_0020702 Ga0451576_0020702_3869_4330 147
15 3300005445 Ga0070708_100174900 Ga0070708_1001749002 148
16 3300005471 Ga0070698_100000844 Ga0070698_10000084411 148
17 3300005518 Ga0070699_100022461 Ga0070699_1000224614 148
18 3300037853 Ga0436364_0262447 Ga0436364_0262447_85_600 148
19 3300005435 Ga0070714_100218320 Ga0070714_1002183202 149
20 3300005435 Ga0070714_100450383 Ga0070714_1004503832 149
21 3300025929 Ga0207664_10344494 Ga0207664_103444943 149
22 3300025929 Ga0207664_10398548 Ga0207664_103985482 149
23 3300046523 Ga0495644_0086600 Ga0495644_0086600_22_543 152
24 3300046537 Ga0495598_0072062 Ga0495598_0072062_379_900 152
25 3300046691 Ga0495670_0100112 Ga0495670_0100112_816_1337 152
26 3300044712 Ga0453684_0556377 Ga0453684_0556377_400_870 153
27 3300021384 Ga0213876_10043642 Ga0213876_100436423 154
28 3300021388 Ga0213875_10032872 Ga0213875_100328723 154
29 3300005563 Ga0068855_100035495 Ga0068855_1000354957 155
30 3300005614 Ga0068856_101087353 Ga0068856_1010873532 155
31 3300009093 Ga0105240_10825401 Ga0105240_108254012 155
32 3300025913 Ga0207695_10492135 Ga0207695_104921352 155
33 3300025949 Ga0207667_10326792 Ga0207667_103267923 155
34 3300026142 Ga0207698_10015252 Ga0207698_100152524 155
35 3300039437 Ga0436365_0972891 Ga0436365_0972891_1166_1699 155
36 3300005436 Ga0070713_100006853 Ga0070713_1000068538 156
37 3300025928 Ga0207700_10445063 Ga0207700_104450632 156
38 3300005366 Ga0070659_100609375 Ga0070659_1006093752 158
39 3300005439 Ga0070711_100071183 Ga0070711_1000711832 158
40 3300005455 Ga0070663_100562746 Ga0070663_1005627462 158
41 3300005456 Ga0070678_100045230 Ga0070678_1000452303 158
42 3300005530 Ga0070679_100487962 Ga0070679_1004879622 158
43 3300005536 Ga0070697_100440104 Ga0070697_1004401041 158
44 3300005539 Ga0068853_100071631 Ga0068853_1000716313 158
45 3300005545 Ga0070695_100061261 Ga0070695_1000612614 158
46 3300005563 Ga0068855_100115301 Ga0068855_1001153015 158
47 3300005563 Ga0068855_100244539 Ga0068855_1002445393 158
48 3300005564 Ga0070664_100037018 Ga0070664_1000370184 158
49 3300005614 Ga0068856_100023254 Ga0068856_1000232545 158
50 3300005937 Ga0081455_10012102 Ga0081455_100121022 158
51 3300006028 Ga0070717_10066010 Ga0070717_100660105 158
52 3300006358 Ga0068871_100983540 Ga0068871_1009835402 158
53 3300006914 Ga0075436_100815669 Ga0075436_1008156691 158
54 3300009098 Ga0105245_10387315 Ga0105245_103873151 158
55 3300013100 Ga0157373_10025082 Ga0157373_100250824 158
56 3300013100 Ga0157373_10190788 Ga0157373_101907882 158
57 3300013102 Ga0157371_10283277 Ga0157371_102832772 158
58 3300013104 Ga0157370_10202599 Ga0157370_102025993 158
59 3300013105 Ga0157369_10000849 Ga0157369_1000084929 158
60 3300013105 Ga0157369_10061844 Ga0157369_100618444 158
61 3300013105 Ga0157369_10101809 Ga0157369_101018095 158
62 3300013296 Ga0157374_10005812 Ga0157374_100058128 158
63 3300013307 Ga0157372_10186342 Ga0157372_101863424 158
64 3300013307 Ga0157372_10219342 Ga0157372_102193424 158
65 3300014969 Ga0157376_10190714 Ga0157376_101907142 158
66 3300025912 Ga0207707_10007323 Ga0207707_100073237 158
67 3300025916 Ga0207663_10064107 Ga0207663_100641072 158
68 3300025919 Ga0207657_10126536 Ga0207657_101265363 158
69 3300025920 Ga0207649_10275921 Ga0207649_102759213 158
70 3300025921 Ga0207652_10392055 Ga0207652_103920552 158
71 3300025927 Ga0207687_10373691 Ga0207687_103736912 158
72 3300025932 Ga0207690_10520826 Ga0207690_105208262 158
73 3300025933 Ga0207706_10114033 Ga0207706_101140334 158
74 3300025945 Ga0207679_10054603 Ga0207679_100546034 158
75 3300025949 Ga0207667_10094817 Ga0207667_100948171 158
76 3300026023 Ga0207677_10412516 Ga0207677_104125162 158
77 3300026078 Ga0207702_10036777 Ga0207702_100367775 158
78 3300026121 Ga0207683_10065535 Ga0207683_100655353 158
79 3300031247 Ga0265340_10260489 Ga0265340_102604892 158
80 3300031250 Ga0265331_10066735 Ga0265331_100667352 158
81 3300035111 Ga0373923_0354963 Ga0373923_0354963_214_690 158
82 3300035118 Ga0373954_0081011 Ga0373954_0081011_214_690 158
83 3300035695 Ga0373927_0898305 Ga0373927_0898305_85_561 158
84 3300035725 Ga0373947_0680268 Ga0373947_0680268_159_635 158
85 3300036401 Ga0373937_0413218 Ga0373937_0413218_26_502 158
86 3300037068 Ga0373925_1563997 Ga0373925_1563997_20_496 158
87 3300045051 Ga0451576_0567066 Ga0451576_0567066_684_1160 158
88 3300046472 Ga0495580_0135099 Ga0495580_0135099_163_639 158
89 3300046475 Ga0495639_0204763 Ga0495639_0204763_269_745 158
90 3300046684 Ga0495669_0275152 Ga0495669_0275152_71_547 158
91 3300047319 Ga0495674_0565703 Ga0495674_0565703_37_513 158
92 3300048913 Ga0496110_0533404 Ga0496110_0533404_79_564 158
93 3300048915 Ga0496112_0017387 Ga0496112_0017387_5105_5590 158
94 3300048918 Ga0496115_0034389 Ga0496115_0034389_1940_2425 158
95 3300005364 Ga0070673_101430994 Ga0070673_1014309941 159
96 3300005434 Ga0070709_10453757 Ga0070709_104537572 159
97 3300005436 Ga0070713_100977439 Ga0070713_1009774391 159
98 3300005466 Ga0070685_11116712 Ga0070685_111167121 159
99 3300005617 Ga0068859_100385920 Ga0068859_1003859202 159
100 3300006931 Ga0097620_100385955 Ga0097620_1003859552 159
101 3300009174 Ga0105241_11491987 Ga0105241_114919871 159
102 3300013100 Ga0157373_10163576 Ga0157373_101635763 159
103 3300013104 Ga0157370_10146624 Ga0157370_101466243 159
104 3300013296 Ga0157374_10488511 Ga0157374_104885112 159
105 3300013307 Ga0157372_11074401 Ga0157372_110744011 159
106 3300014326 Ga0157380_10094603 Ga0157380_100946032 159
107 3300021361 Ga0213872_10002198 Ga0213872_100021982 159
108 3300021377 Ga0213874_10015728 Ga0213874_100157283 159
109 3300021377 Ga0213874_10018199 Ga0213874_100181993 159
110 3300021384 Ga0213876_10000572 Ga0213876_1000057228 159
111 3300021384 Ga0213876_10010177 Ga0213876_100101778 159
112 3300021384 Ga0213876_10127180 Ga0213876_101271802 159
113 3300021384 Ga0213876_10164294 Ga0213876_101642941 159
114 3300021388 Ga0213875_10000019 Ga0213875_10000019143 159
115 3300021388 Ga0213875_10000566 Ga0213875_100005667 159
116 3300021388 Ga0213875_10010465 Ga0213875_100104653 159
117 3300021388 Ga0213875_10016785 Ga0213875_100167852 159
118 3300021388 Ga0213875_10020748 Ga0213875_100207482 159
119 3300021388 Ga0213875_10070024 Ga0213875_100700242 159
120 3300021388 Ga0213875_10283134 Ga0213875_102831342 159
121 3300021441 Ga0213871_10017500 Ga0213871_100175002 159
122 3300026078 Ga0207702_10590463 Ga0207702_105904632 159
123 3300031344 Ga0265316_10017565 Ga0265316_100175655 159
124 3300037418 Ga0395900_1465269 Ga0395900_1465269_24_572 159
125 3300037853 Ga0436364_0093151 Ga0436364_0093151_1546_2043 159
126 3300037853 Ga0436364_0141814 Ga0436364_0141814_507_1043 159
127 3300037853 Ga0436364_0210103 Ga0436364_0210103_67_597 159
128 3300037853 Ga0436364_0245405 Ga0436364_0245405_291_830 159
129 3300037853 Ga0436364_0261665 Ga0436364_0261665_2369_2896 159
130 3300037853 Ga0436364_0265125 Ga0436364_0265125_11120_11656 159
131 3300037853 Ga0436364_0366372 Ga0436364_0366372_81312_81857 159
132 3300037853 Ga0436364_0417100 Ga0436364_0417100_1533_2018 159
133 3300037853 Ga0436364_0443936 Ga0436364_0443936_206_742 159
134 3300037853 Ga0436364_0476408 Ga0436364_0476408_793_1275 159
135 3300037853 Ga0436364_0769849 Ga0436364_0769849_643_1182 159
136 3300037853 Ga0436364_0941496 Ga0436364_0941496_507_1040 159
137 3300037853 Ga0436364_0959382 Ga0436364_0959382_886_1422 159
138 3300037853 Ga0436364_1372089 Ga0436364_1372089_2750_3295 159
139 3300037853 Ga0436364_1450970 Ga0436364_1450970_1052_1585 159
140 3300037853 Ga0436364_1528714 Ga0436364_1528714_63695_64222 159
141 3300039437 Ga0436365_0206992 Ga0436365_0206992_1081_1602 159
142 3300039437 Ga0436365_0382553 Ga0436365_0382553_249_773 159
143 3300039437 Ga0436365_1007960 Ga0436365_1007960_7592_8125 159
144 3300039437 Ga0436365_1310216 Ga0436365_1310216_3393_3929 159
145 3300039437 Ga0436365_1356056 Ga0436365_1356056_902_1438 159
146 3300039437 Ga0436365_1374793 Ga0436365_1374793_1150_1635 159
147 3300039437 Ga0436365_1667551 Ga0436365_1667551_110_643 159
148 3300039438 Ga0436360_0913928 Ga0436360_0913928_13126_13638 159
149 3300039438 Ga0436360_0924594 Ga0436360_0924594_75_614 159
150 3300039447 Ga0436361_0139021 Ga0436361_0139021_24037_24573 159
151 3300039450 Ga0436363_0124517 Ga0436363_0124517_246_734 159
152 3300039450 Ga0436363_0194633 Ga0436363_0194633_1843_2370 159
153 3300039450 Ga0436363_0506899 Ga0436363_0506899_1708_2193 159
154 3300039450 Ga0436363_0691483 Ga0436363_0691483_8283_8804 159
155 3300039450 Ga0436363_1517604 Ga0436363_1517604_41_625 159
156 3300039453 Ga0436362_0045582 Ga0436362_0045582_39_572 159
157 3300039453 Ga0436362_0376022 Ga0436362_0376022_544_1056 159
158 3300039453 Ga0436362_0614913 Ga0436362_0614913_2868_3353 159
159 3300039453 Ga0436362_1248524 Ga0436362_1248524_130_666 159
160 3300044673 Ga0453683_0897339 Ga0453683_0897339_33_539 159
161 3300044684 Ga0466966_0068158 Ga0466966_0068158_1205_1732 159
162 3300044694 Ga0466963_0410425 Ga0466963_0410425_222_713 159
163 3300045051 Ga0451576_1449960 Ga0451576_1449960_67_558 159
164 3300045976 Ga0466967_0180553 Ga0466967_0180553_68_571 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

57

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9787 10 151
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9766 10 150
3sps-assembly1.cif.gz_B crystal structure of apo-hexameric acyl-coa thioesterase 0.9763 1 151
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9744 8 152
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9729 10 151
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9787 10 151 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9697 2 151 3.10.129.10
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9621 4 145 3.10.129.10
af_I1KGM5_8_116_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9601 8 76 3.10.129.10
2eisB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9583 14 129 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7V2MFH0-F1-model_v4 Acyl-CoA thioesterase 0.9956 1 155 GO:0005829
GO:0006637
GO:0052816
AF-A0A1F8TG05-F1-model_v4 Acyl-CoA thioesterase 0.9923 3 151 GO:0005829
GO:0006637
GO:0052816
AF-A0A2E6DIE9-F1-model_v4 deleted 0.9919 2 154
AF-A0A537XT81-F1-model_v4 Acyl-CoA thioesterase 0.9916 3 158 GO:0005829
GO:0006637
GO:0052816
AF-F3YV20-F1-model_v4 Thioesterase superfamily protein 0.9914 1 157 GO:0005829
GO:0006637
GO:0052816

Feature Viewer

pLDDT pTM Quality
93.52 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map