F244875

General Info

Members Datasets Scaffolds Average Seq Length
164 114 328 154

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_6_c1|nmdc:mga07m45_6_c1_8098_8622
Length 174
Sequence LSGDLNVEDINGEPATCGLAILWHSRTGAAQAMARAAADGAGEGALLVRADEAEPELFLLARGYLFVCPENLASMSGAMKEMFDRCYYPLLSRIEGRPYATAIAAGSDGTQAQAQIDRIVTGWRLRRVAEPLIVNLGAQSPEAILAPKNLSSAATQQCRDLGMMMAEGLRLGIY

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
83 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
84 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
88 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
89 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
90 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
91 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
92 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
93 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
96 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
97 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
98 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
99 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
100 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
101 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
107 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
108 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
109 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
110 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
111 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
112 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
113 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
114 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.46
Metatranscriptomes 3.05
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0
Rhizoplane 2.44
Rhizosphere 65.24
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
2 SwRhRL2b_contig_2447314 2162886007 Bacteria 6982
3 Ga0065704_10070447 3300005289 Bacteria 24411
4 Ga0070670_100020848 3300005331 Bacteria 5636
5 Ga0070670_100222394 3300005331 Bacteria 1643
6 Ga0070668_100002953 3300005347 Bacteria 12570
7 Ga0070671_100003290 3300005355 Bacteria 12610
8 Ga0070671_100159917 3300005355 Bacteria 1904
9 Ga0070671_101753624 3300005355 Bacteria 551
10 Ga0070667_100001006 3300005367 Bacteria 25830
11 Ga0070667_100043406 3300005367 Bacteria 3773
12 Ga0070706_100484891 3300005467 Bacteria 1150
13 Ga0070665_100033583 3300005548 Bacteria 5163
14 Ga0068857_100160894 3300005577 Bacteria 2037
15 Ga0068854_100007618 3300005578 Bacteria 6924
16 Ga0068852_100119349 3300005616 Bacteria 2411
17 Ga0068852_100650184 3300005616 Bacteria 1062
18 Ga0068859_100004701 3300005617 Bacteria 13892
19 Ga0068864_100147881 3300005618 Bacteria 2125
20 Ga0068861_100043364 3300005719 Bacteria 3376
21 Ga0068863_100000676 3300005841 Bacteria 34484
22 Ga0068863_100005564 3300005841 Bacteria 12385
23 Ga0068858_100027140 3300005842 Bacteria 5319
24 Ga0068858_100197778 3300005842 Bacteria 1900
25 Ga0068860_100000007 3300005843 Bacteria 429329
26 Ga0068860_100020466 3300005843 Bacteria 6408
27 Ga0068860_100177465 3300005843 Bacteria 2059
28 Ga0068860_101265281 3300005843 Bacteria 758
29 Ga0068862_100008557 3300005844 Bacteria 8467
30 Ga0068862_100114867 3300005844 Bacteria 2367
31 Ga0075368_10001343 3300006042 Bacteria 7820
32 Ga0075364_10001650 3300006051 Bacteria 12260
33 Ga0075364_10002886 3300006051 Bacteria 9690
34 Ga0075362_10001327 3300006177 Bacteria 7824
35 Ga0075367_10001461 3300006178 Bacteria 10189
36 Ga0075370_10000003 3300006353 Bacteria 133163
37 Ga0075370_10012373 3300006353 Bacteria 4508
38 Ga0075370_10076736 3300006353 Bacteria 1917
39 Ga0075370_10522263 3300006353 Bacteria 717
40 Ga0075430_100146830 3300006846 Unclassified 1964
41 Ga0097620_100004701 3300006931 Bacteria 13892
42 Ga0105240_10070565 3300009093 Bacteria 4321
43 Ga0105240_11634316 3300009093 Bacteria 674
44 Ga0105240_12574891 3300009093 Bacteria 526
45 Ga0105248_10002083 3300009177 Bacteria 22124
46 Ga0105248_10006520 3300009177 Bacteria 12796
47 Ga0157371_10493411 3300013102 Bacteria 904
48 Ga0157378_10013786 3300013297 Bacteria 7071
49 Ga0163162_10006444 3300013306 Bacteria 11369
50 Ga0163163_10001956 3300014325 Bacteria 17425
51 Ga0157379_10000505 3300014968 Bacteria 31681
52 Ga0207681_10006974 3300025923 Bacteria 6933
53 Ga0207650_10012993 3300025925 Bacteria 5759
54 Ga0207650_10178418 3300025925 Bacteria 1692
55 Ga0207644_10005782 3300025931 Bacteria 8049
56 Ga0207644_10461375 3300025931 Bacteria 1044
57 Ga0207644_11238608 3300025931 Bacteria 627
58 Ga0207711_10002892 3300025941 Bacteria 15046
59 Ga0207711_10013491 3300025941 Bacteria 6785
60 Ga0207668_10007833 3300025972 Bacteria 6355
61 Ga0207640_10001190 3300025981 Bacteria 14221
62 Ga0207658_10001511 3300025986 Bacteria 18082
63 Ga0207658_10007797 3300025986 Bacteria 7291
64 Ga0207658_10095117 3300025986 Bacteria 2320
65 Ga0207703_10076675 3300026035 Bacteria 2774
66 Ga0207641_10050390 3300026088 Bacteria 3522
67 Ga0207676_10121652 3300026095 Bacteria 2202
68 Ga0207674_10167737 3300026116 Bacteria 2149
69 Ga0207675_100115266 3300026118 Bacteria 2539
70 Ga0207698_10257154 3300026142 Bacteria 1602
71 Ga0207698_10948833 3300026142 Bacteria 869
72 Ga0209813_10000132 3300027866 Bacteria 26788
73 Ga0268266_10035387 3300028379 Bacteria 4248
74 Ga0268266_10084111 3300028379 Bacteria 2778
75 Ga0268266_11860460 3300028379 Bacteria 576
76 Ga0268265_10098943 3300028380 Bacteria 2350
77 Ga0268264_10000077 3300028381 Bacteria 252597
78 Ga0268264_10039388 3300028381 Bacteria 3905
79 Ga0268264_10154304 3300028381 Bacteria 2062
80 Ga0265327_10017804 3300031251 Bacteria 4434
81 Ga0307408_100406048 3300031548 Bacteria 1171
82 Ga0307405_10000277 3300031731 Bacteria 18938
83 Ga0307405_10968591 3300031731 Bacteria 724
84 Ga0307413_10155764 3300031824 Bacteria 1598
85 Ga0307410_10592402 3300031852 Bacteria 924
86 Ga0307406_10161310 3300031901 Bacteria 1612
87 Ga0307407_10006391 3300031903 Bacteria 5229
88 Ga0307412_10059753 3300031911 Bacteria 2556
89 Ga0307412_10801898 3300031911 Bacteria 817
90 Ga0307409_100035134 3300031995 Bacteria 3669
91 Ga0307411_10977235 3300032005 Bacteria 757
92 Ga0307415_100016759 3300032126 Bacteria 4377
93 Ga0307415_101357866 3300032126 Unclassified 675
94 Ga0373962_0049603 3300035242 Bacteria 1207
95 Ga0373931_0976068 3300035691 Bacteria 572
96 Ga0451576_0000007 3300045051 Bacteria 782228
97 Ga0495607_0481588 3300046501 Bacteria 553
98 Ga0495648_0257432 3300046524 Bacteria 839
99 Ga0495654_0036597 3300046530 Bacteria 2466
100 Ga0495668_0129801 3300046616 Bacteria 1380
101 Ga0495668_0285580 3300046616 Bacteria 904
102 Ga0495625_0030329 3300046660 Bacteria 4037
103 Ga0495670_0200451 3300046691 Bacteria 1057
104 Ga0496101_0141588 3300048904 Bacteria 1833
105 Ga0496103_0256149 3300048906 Bacteria 1126
106 Ga0496104_0019858 3300048907 Bacteria 6154
107 Ga0496105_0021244 3300048908 Bacteria 5253
108 Ga0496118_0084126 3300048921 Bacteria 2221
109 Ga0496118_0138051 3300048921 Bacteria 1552
110 Ga0496119_0199100 3300048922 Bacteria 1038
111 Ga0496120_0290841 3300048923 Bacteria 752
112 Ga0496121_0000509 3300048924 Bacteria 74211
113 Ga0496121_0356073 3300048924 Bacteria 973
114 Ga0501034_0444109 3300049571 Bacteria 1216
115 Ga0501042_0105101 3300049578 Bacteria 2032
116 Ga0501044_0002311 3300049823 Bacteria 21722
117 Ga0501044_0560590 3300049823 Bacteria 1039
118 Ga0501044_0602291 3300049823 Bacteria 992
119 Ga0501044_0806559 3300049823 Bacteria 818
120 nmdc:mga03683_192_c1 3300050489 Bacteria 20102
121 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
122 nmdc:mga03n38_9620_c1 3300050490 Bacteria 3524
123 nmdc:mga00v17_2648_c1 3300050491 Bacteria 6665
124 nmdc:mga00v17_27175_c1 3300050491 Bacteria 3339
125 nmdc:mga00v17_434_c1 3300050491 Bacteria 23482
126 nmdc:mga0yw44_42522_c1 3300050492 Bacteria 2710
127 nmdc:mga0k408_10661_c1 3300050493 Bacteria 4977
128 nmdc:mga0k408_733882_c1 3300050493 Bacteria 577
129 nmdc:mga0k408_852772_c1 3300050493 Bacteria 530
130 nmdc:mga06z11_467_c1 3300050494 Bacteria 15048
131 nmdc:mga04h51_343_c1 3300050495 Bacteria 11595
132 nmdc:mga07m45_34700_c1 3300050496 Bacteria 2804
133 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
134 nmdc:mga07m45_49973_c1 3300050496 Bacteria 1070
135 nmdc:mga0qj67_191868_c1 3300050509 Unclassified 1660
136 nmdc:mga0sz30_2862_c1 3300050516 Bacteria 6168
137 nmdc:mga0sz30_4838_c1 3300050516 Bacteria 4171
138 Ga0500641_0015509 3300053096 Bacteria 2831
139 Ga0500555_051757 3300053103 Bacteria 1122
140 Ga0500607_000324 3300053121 Bacteria 45136
141 Ga0500607_001004 3300053121 Bacteria 26809
142 Ga0500608_337231 3300053122 Bacteria 541
143 Ga0500559_0002165 3300053136 Bacteria 10411
144 Ga0500559_0003138 3300053136 Bacteria 8212
145 Ga0500559_0269089 3300053136 Bacteria 802
146 Ga0500564_001449 3300053138 Bacteria 8196
147 Ga0500590_122133 3300053148 Bacteria 1219
148 Ga0500636_0238064 3300053177 Bacteria 937
149 Ga0500567_039328 3300053723 Bacteria 2211
150 Ga0500645_001536 3300053730 Bacteria 11527
151 Ga0587084_000985 3300059477 Bacteria 2539
152 Ga0587070_003853 3300059491 Bacteria 1846
153 Ga0587082_005583 3300059504 Bacteria 1641
154 Ga0587090_001637 3300059510 Bacteria 2311
155 Ga0587111_0005108 3300060346 Bacteria 2001
156 2738709305 2738541275 Bacteria 4830863
157 2738847730 2738541301 Bacteria 4834102
158 2738863459 2738541304 Bacteria 4833665
159 2739295977 2738543022 Bacteria 4835059
160 2739357655 2738543033 Bacteria 4833336
161 2882807906 2882806704 Bacteria 3007728
162 2928102905 2928100450 Bacteria 4837635
163 2928959471 2928959182 Bacteria 4725774
164 8054305730 8054302542 Bacteria 5698134
165 nmdc:mga07m45_6_c1
166 SwRhRL2b_contig_2447314
167 Ga0065704_10070447
168 Ga0070670_100020848
169 Ga0070670_100222394
170 Ga0070668_100002953
171 Ga0070671_100003290
172 Ga0070671_100159917
173 Ga0070671_101753624
174 Ga0070667_100001006
175 Ga0070667_100043406
176 Ga0070706_100484891
177 Ga0070665_100033583
178 Ga0068857_100160894
179 Ga0068854_100007618
180 Ga0068852_100119349
181 Ga0068852_100650184
182 Ga0068859_100004701
183 Ga0068864_100147881
184 Ga0068861_100043364
185 Ga0068863_100000676
186 Ga0068863_100005564
187 Ga0068858_100027140
188 Ga0068858_100197778
189 Ga0068860_100000007
190 Ga0068860_100020466
191 Ga0068860_100177465
192 Ga0068860_101265281
193 Ga0068862_100008557
194 Ga0068862_100114867
195 Ga0075368_10001343
196 Ga0075364_10001650
197 Ga0075364_10002886
198 Ga0075362_10001327
199 Ga0075367_10001461
200 Ga0075370_10000003
201 Ga0075370_10012373
202 Ga0075370_10076736
203 Ga0075370_10522263
204 Ga0075430_100146830
205 Ga0097620_100004701
206 Ga0105240_10070565
207 Ga0105240_11634316
208 Ga0105240_12574891
209 Ga0105248_10002083
210 Ga0105248_10006520
211 Ga0157371_10493411
212 Ga0157378_10013786
213 Ga0163162_10006444
214 Ga0163163_10001956
215 Ga0157379_10000505
216 Ga0207681_10006974
217 Ga0207650_10012993
218 Ga0207650_10178418
219 Ga0207644_10005782
220 Ga0207644_10461375
221 Ga0207644_11238608
222 Ga0207711_10002892
223 Ga0207711_10013491
224 Ga0207668_10007833
225 Ga0207640_10001190
226 Ga0207658_10001511
227 Ga0207658_10007797
228 Ga0207658_10095117
229 Ga0207703_10076675
230 Ga0207641_10050390
231 Ga0207676_10121652
232 Ga0207674_10167737
233 Ga0207675_100115266
234 Ga0207698_10257154
235 Ga0207698_10948833
236 Ga0209813_10000132
237 Ga0268266_10035387
238 Ga0268266_10084111
239 Ga0268266_11860460
240 Ga0268265_10098943
241 Ga0268264_10000077
242 Ga0268264_10039388
243 Ga0268264_10154304
244 Ga0265327_10017804
245 Ga0307408_100406048
246 Ga0307405_10000277
247 Ga0307405_10968591
248 Ga0307413_10155764
249 Ga0307410_10592402
250 Ga0307406_10161310
251 Ga0307407_10006391
252 Ga0307412_10059753
253 Ga0307412_10801898
254 Ga0307409_100035134
255 Ga0307411_10977235
256 Ga0307415_100016759
257 Ga0307415_101357866
258 Ga0373962_0049603
259 Ga0373931_0976068
260 Ga0451576_0000007
261 Ga0495607_0481588
262 Ga0495648_0257432
263 Ga0495654_0036597
264 Ga0495668_0129801
265 Ga0495668_0285580
266 Ga0495625_0030329
267 Ga0495670_0200451
268 Ga0496101_0141588
269 Ga0496103_0256149
270 Ga0496104_0019858
271 Ga0496105_0021244
272 Ga0496118_0084126
273 Ga0496118_0138051
274 Ga0496119_0199100
275 Ga0496120_0290841
276 Ga0496121_0000509
277 Ga0496121_0356073
278 Ga0501034_0444109
279 Ga0501042_0105101
280 Ga0501044_0002311
281 Ga0501044_0560590
282 Ga0501044_0602291
283 Ga0501044_0806559
284 nmdc:mga03683_192_c1
285 nmdc:mga03683_61_c1
286 nmdc:mga03n38_9620_c1
287 nmdc:mga00v17_2648_c1
288 nmdc:mga00v17_27175_c1
289 nmdc:mga00v17_434_c1
290 nmdc:mga0yw44_42522_c1
291 nmdc:mga0k408_10661_c1
292 nmdc:mga0k408_733882_c1
293 nmdc:mga0k408_852772_c1
294 nmdc:mga06z11_467_c1
295 nmdc:mga04h51_343_c1
296 nmdc:mga07m45_34700_c1
297 nmdc:mga07m45_38_c1
298 nmdc:mga07m45_49973_c1
299 nmdc:mga0qj67_191868_c1
300 nmdc:mga0sz30_2862_c1
301 nmdc:mga0sz30_4838_c1
302 Ga0500641_0015509
303 Ga0500555_051757
304 Ga0500607_000324
305 Ga0500607_001004
306 Ga0500608_337231
307 Ga0500559_0002165
308 Ga0500559_0003138
309 Ga0500559_0269089
310 Ga0500564_001449
311 Ga0500590_122133
312 Ga0500636_0238064
313 Ga0500567_039328
314 Ga0500645_001536
315 Ga0587084_000985
316 Ga0587070_003853
317 Ga0587082_005583
318 Ga0587090_001637
319 Ga0587111_0005108
320 2738709305
321 2738847730
322 2738863459
323 2739295977
324 2739357655
325 2882807906
326 2928102905
327 2928959471
328 8054305730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

56

137

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohh-assembly1.cif.gz_A crystal structure of coenzyme f420h2 oxidase (fpra), a diiron flavoprotein, active oxidized state 0.8417 2 150
3nll-assembly1.cif.gz_A clostridium beijerinckii flavodoxin mutant: g57a oxidized 0.8301 1 150
1zwk-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa 0.8293 2 150
4nll-assembly1.cif.gz_A clostridium beijerinckii flavodoxin mutant: g57d oxidized 0.8285 1 150
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8269 1 153
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8541 2 152 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8431 1 150 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8324 1 150 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8274 2 152 3.40.50.360
1flnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8232 1 150 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A653J1D2-F1-model_v4 Flavodoxin 0.9873 1 157 GO:0010181
GO:0016491
AF-A0A7W7NU92-F1-model_v4 Flavodoxin-like domain-containing protein 0.9856 1 157 GO:0010181
GO:0016491
AF-A0A0W1DDQ8-F1-model_v4 Flavodoxin 0.9814 2 157 GO:0016491
AF-A0A7X1FWY3-F1-model_v4 Flavodoxin family protein 0.9808 2 157 GO:0016491
AF-A0A7W7NU92-F1-model_v4 Flavodoxin-like domain-containing protein 0.9794 1 157 GO:0010181
GO:0016491

Map