F245286

General Info

Members Datasets Scaffolds Average Seq Length
165 125 330 111

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10441046|Ga0065707_104410462
Length 124
Sequence MDILRNLFGNLTSGIIRLLVTVGILAAAYFFIVKPVLKSTDNAINRGFDSAKEANESFEKSFGPDGANLGDINKTIDSVNHQVQVQIERSFHTAKKHGNPNKLVRCVQHAEGNVQKIKRCTVKF

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.15
Rhizosphere 78.79
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10441046 3300005295 Bacteria 810
2 JGI25404J52841_10004265 3300003659 Bacteria 2883
3 Ga0070670_100420169 3300005331 Bacteria 1182
4 Ga0070670_101049794 3300005331 Bacteria 742
5 Ga0070682_100721133 3300005337 Bacteria 802
6 Ga0068868_100007565 3300005338 Bacteria 7738
7 Ga0070691_10000010 3300005341 Bacteria 58327
8 Ga0070668_100355724 3300005347 Bacteria 1240
9 Ga0070668_100587766 3300005347 Bacteria 973
10 Ga0070668_100694211 3300005347 Unclassified 897
11 Ga0070675_100000008 3300005354 Bacteria 250004
12 Ga0070674_100000016 3300005356 Bacteria 91058
13 Ga0070688_100006705 3300005365 Bacteria 6168
14 Ga0070714_100155529 3300005435 Bacteria 2064
15 Ga0070713_100000055 3300005436 Bacteria 70759
16 Ga0070711_100032527 3300005439 Bacteria 3467
17 Ga0070685_10254074 3300005466 Bacteria 1165
18 Ga0070684_100457758 3300005535 Bacteria 1180
19 Ga0070672_100000036 3300005543 Bacteria 59645
20 Ga0070695_100278984 3300005545 Bacteria 1227
21 Ga0070665_100253783 3300005548 Bacteria 1759
22 Ga0068856_101883622 3300005614 Bacteria 609
23 Ga0068852_100008635 3300005616 Bacteria 7527
24 Ga0068859_102378465 3300005617 Bacteria 584
25 Ga0068866_10000568 3300005718 Bacteria 16784
26 Ga0068861_100308368 3300005719 Bacteria 1374
27 Ga0068863_100030893 3300005841 Bacteria 5116
28 Ga0068863_100088380 3300005841 Bacteria 2937
29 Ga0068858_100000218 3300005842 Bacteria 61860
30 Ga0068860_100730933 3300005843 Bacteria 1001
31 Ga0068862_100468145 3300005844 Bacteria 1191
32 Ga0081540_1000419 3300005983 Bacteria 41957
33 Ga0081539_10000615 3300005985 Bacteria 72134
34 Ga0081539_10012163 3300005985 Bacteria 6678
35 Ga0097621_100913502 3300006237 Bacteria 818
36 Ga0075433_11552621 3300006852 Unclassified 571
37 Ga0075436_100282656 3300006914 Bacteria 1187
38 Ga0097620_102377984 3300006931 Bacteria 584
39 Ga0105240_10261675 3300009093 Bacteria 1995
40 Ga0105247_11816538 3300009101 Bacteria 507
41 Ga0105243_10116833 3300009148 Bacteria 2242
42 Ga0105242_10000010 3300009176 Bacteria 151649
43 Ga0105242_10269978 3300009176 Bacteria 1540
44 Ga0105242_10593716 3300009176 Bacteria 1068
45 Ga0105248_10000022 3300009177 Bacteria 275935
46 Ga0105249_10931145 3300009553 Bacteria 936
47 Ga0105249_12845907 3300009553 Bacteria 555
48 Ga0157370_10013601 3300013104 Bacteria 8374
49 Ga0157370_10226829 3300013104 Bacteria 1729
50 Ga0157374_10260551 3300013296 Bacteria 1708
51 Ga0157378_10006375 3300013297 Bacteria 10318
52 Ga0157375_10102732 3300013308 Bacteria 2944
53 Ga0207642_10005429 3300025899 Bacteria 4161
54 Ga0207710_10374321 3300025900 Bacteria 728
55 Ga0207663_10070908 3300025916 Bacteria 2247
56 Ga0207659_10000062 3300025926 Bacteria 67607
57 Ga0207700_10000009 3300025928 Bacteria 314953
58 Ga0207700_10342443 3300025928 Bacteria 1300
59 Ga0207664_10104359 3300025929 Bacteria 2347
60 Ga0207644_10110256 3300025931 Bacteria 2080
61 Ga0207686_10000107 3300025934 Bacteria 67766
62 Ga0207686_10057053 3300025934 Bacteria 2457
63 Ga0207686_10162640 3300025934 Bacteria 1566
64 Ga0207669_10000037 3300025937 Bacteria 77494
65 Ga0207711_10000019 3300025941 Bacteria 412779
66 Ga0207661_10000399 3300025944 Bacteria 28078
67 Ga0207667_12229405 3300025949 Unclassified 504
68 Ga0207668_10419840 3300025972 Bacteria 1135
69 Ga0207668_11298621 3300025972 Unclassified 655
70 Ga0207677_10006151 3300026023 Bacteria 6558
71 Ga0207703_10000028 3300026035 Bacteria 208682
72 Ga0207702_12118829 3300026078 Bacteria 552
73 Ga0207641_10032317 3300026088 Bacteria 4344
74 Ga0207641_10110090 3300026088 Bacteria 2440
75 Ga0207698_10484120 3300026142 Bacteria 1201
76 Ga0268266_10057885 3300028379 Bacteria 3336
77 Ga0265326_10092451 3300028558 Bacteria 857
78 Ga0265319_1000227 3300028563 Bacteria 42176
79 Ga0265336_10019960 3300028666 Bacteria 2157
80 Ga0265338_10000383 3300028800 Bacteria 79248
81 Ga0265325_10015941 3300031241 Bacteria 4210
82 Ga0265331_10208628 3300031250 Bacteria 879
83 Ga0373947_1186200 3300035725 Bacteria 520
84 Ga0451807_1310700 3300041486 Bacteria 1635
85 Ga0451807_2305455 3300041486 Bacteria 1524
86 Ga0451833_0258232 3300041491 Bacteria 2769
87 Ga0451837_0640370 3300041494 Bacteria 1403
88 Ga0451849_0235713 3300041505 Bacteria 1892
89 Ga0451849_0381942 3300041505 Bacteria 897
90 Ga0451849_0925052 3300041505 Unclassified 672
91 Ga0451853_0304656 3300041512 Bacteria 3980
92 Ga0451853_2363541 3300041512 Bacteria 2322
93 Ga0451853_2840218 3300041512 Bacteria 993
94 Ga0466957_0438743 3300044842 Bacteria 898
95 Ga0466967_0000008 3300045976 Bacteria 127135
96 Ga0495592_0071867 3300046454 Bacteria 2518
97 Ga0495629_0000028 3300046459 Bacteria 127409
98 Ga0495629_0002192 3300046459 Bacteria 15074
99 Ga0495629_0055902 3300046459 Bacteria 2760
100 Ga0495651_0507695 3300046462 Bacteria 771
101 Ga0495653_0144398 3300046463 Bacteria 1670
102 Ga0495653_0712767 3300046463 Bacteria 609
103 Ga0495662_0067890 3300046476 Bacteria 1726
104 Ga0495606_0000219 3300046507 Bacteria 101614
105 Ga0495608_0000001 3300046511 Bacteria 411278
106 Ga0495618_0000003 3300046514 Bacteria 256269
107 Ga0495628_0002409 3300046516 Bacteria 16864
108 Ga0495628_0744146 3300046516 Bacteria 689
109 Ga0495630_0000141 3300046517 Bacteria 55652
110 Ga0495630_0002670 3300046517 Bacteria 12360
111 Ga0495644_0317536 3300046523 Unclassified 611
112 Ga0495652_0000003 3300046529 Bacteria 597094
113 Ga0495587_0284614 3300046536 Bacteria 926
114 Ga0495645_0597693 3300046543 Bacteria 679
115 Ga0495667_0000057 3300046559 Bacteria 100656
116 Ga0495634_0000030 3300046642 Bacteria 110741
117 Ga0495634_0797315 3300046642 Unclassified 539
118 Ga0495625_0000154 3300046660 Bacteria 105083
119 Ga0495635_0000006 3300046663 Bacteria 301820
120 Ga0495635_0070085 3300046663 Bacteria 2403
121 Ga0495588_0000195 3300046674 Bacteria 64337
122 Ga0495588_0292868 3300046674 Bacteria 857
123 Ga0495657_0000002 3300046675 Bacteria 411958
124 Ga0495657_0033098 3300046675 Bacteria 3602
125 Ga0495624_0153860 3300046690 Bacteria 1406
126 Ga0495674_0000007 3300047319 Bacteria 336257
127 Ga0495676_0016789 3300047321 Bacteria 6485
128 Ga0495680_0000324 3300047322 Bacteria 53748
129 Ga0495675_0000104 3300047444 Bacteria 60748
130 Ga0495675_0014125 3300047444 Bacteria 5048
131 Ga0496100_0000027 3300048903 Bacteria 115829
132 Ga0496101_0000012 3300048904 Bacteria 268127
133 Ga0496102_0000850 3300048905 Bacteria 29296
134 Ga0496102_1078571 3300048905 Bacteria 723
135 Ga0496103_0000001 3300048906 Bacteria 643471
136 Ga0496106_0000020 3300048909 Bacteria 169168
137 Ga0496107_0000014 3300048910 Bacteria 176738
138 Ga0496108_0806845 3300048911 Bacteria 809
139 Ga0496109_0000035 3300048912 Bacteria 159744
140 Ga0496109_0238217 3300048912 Bacteria 1712
141 Ga0496109_1234719 3300048912 Bacteria 684
142 Ga0496110_0000850 3300048913 Bacteria 21515
143 Ga0496111_0000001 3300048914 Bacteria 194837
144 Ga0496111_0024418 3300048914 Bacteria 4256
145 Ga0496112_0000231 3300048915 Bacteria 35940
146 Ga0496113_0000010 3300048916 Bacteria 86561
147 Ga0496113_0208447 3300048916 Bacteria 1555
148 Ga0496114_0000043 3300048917 Bacteria 131720
149 Ga0496114_0111047 3300048917 Bacteria 2349
150 Ga0496114_0355247 3300048917 Bacteria 1296
151 Ga0496115_0000004 3300048918 Bacteria 319734
152 Ga0496115_0000104 3300048918 Bacteria 79824
153 Ga0496115_0921791 3300048918 Bacteria 672
154 Ga0496118_0220583 3300048921 Bacteria 1104
155 Ga0496124_0368568 3300048927 Unclassified 1009
156 Ga0501042_0084942 3300049578 Bacteria 2270
157 Ga0501081_0104191 3300049743 Bacteria 2008
158 nmdc:mga0n895_1499998_c1 3300050512 Unclassified 640
159 nmdc:mga0a205_1126951_c1 3300050515 Unclassified 632
160 Ga0495601_0086206 3300053077 Bacteria 2018
161 Ga0495655_0000590 3300053083 Bacteria 5956
162 Ga0495595_0000001 3300053084 Bacteria 495226
163 Ga0495619_0000094 3300053085 Bacteria 67416
164 Ga0495619_0000819 3300053085 Bacteria 20379
165 Ga0495619_0023364 3300053085 Bacteria 3963
166 Ga0065707_10441046
167 JGI25404J52841_10004265
168 Ga0070670_100420169
169 Ga0070670_101049794
170 Ga0070682_100721133
171 Ga0068868_100007565
172 Ga0070691_10000010
173 Ga0070668_100355724
174 Ga0070668_100587766
175 Ga0070668_100694211
176 Ga0070675_100000008
177 Ga0070674_100000016
178 Ga0070688_100006705
179 Ga0070714_100155529
180 Ga0070713_100000055
181 Ga0070711_100032527
182 Ga0070685_10254074
183 Ga0070684_100457758
184 Ga0070672_100000036
185 Ga0070695_100278984
186 Ga0070665_100253783
187 Ga0068856_101883622
188 Ga0068852_100008635
189 Ga0068859_102378465
190 Ga0068866_10000568
191 Ga0068861_100308368
192 Ga0068863_100030893
193 Ga0068863_100088380
194 Ga0068858_100000218
195 Ga0068860_100730933
196 Ga0068862_100468145
197 Ga0081540_1000419
198 Ga0081539_10000615
199 Ga0081539_10012163
200 Ga0097621_100913502
201 Ga0075433_11552621
202 Ga0075436_100282656
203 Ga0097620_102377984
204 Ga0105240_10261675
205 Ga0105247_11816538
206 Ga0105243_10116833
207 Ga0105242_10000010
208 Ga0105242_10269978
209 Ga0105242_10593716
210 Ga0105248_10000022
211 Ga0105249_10931145
212 Ga0105249_12845907
213 Ga0157370_10013601
214 Ga0157370_10226829
215 Ga0157374_10260551
216 Ga0157378_10006375
217 Ga0157375_10102732
218 Ga0207642_10005429
219 Ga0207710_10374321
220 Ga0207663_10070908
221 Ga0207659_10000062
222 Ga0207700_10000009
223 Ga0207700_10342443
224 Ga0207664_10104359
225 Ga0207644_10110256
226 Ga0207686_10000107
227 Ga0207686_10057053
228 Ga0207686_10162640
229 Ga0207669_10000037
230 Ga0207711_10000019
231 Ga0207661_10000399
232 Ga0207667_12229405
233 Ga0207668_10419840
234 Ga0207668_11298621
235 Ga0207677_10006151
236 Ga0207703_10000028
237 Ga0207702_12118829
238 Ga0207641_10032317
239 Ga0207641_10110090
240 Ga0207698_10484120
241 Ga0268266_10057885
242 Ga0265326_10092451
243 Ga0265319_1000227
244 Ga0265336_10019960
245 Ga0265338_10000383
246 Ga0265325_10015941
247 Ga0265331_10208628
248 Ga0373947_1186200
249 Ga0451807_1310700
250 Ga0451807_2305455
251 Ga0451833_0258232
252 Ga0451837_0640370
253 Ga0451849_0235713
254 Ga0451849_0381942
255 Ga0451849_0925052
256 Ga0451853_0304656
257 Ga0451853_2363541
258 Ga0451853_2840218
259 Ga0466957_0438743
260 Ga0466967_0000008
261 Ga0495592_0071867
262 Ga0495629_0000028
263 Ga0495629_0002192
264 Ga0495629_0055902
265 Ga0495651_0507695
266 Ga0495653_0144398
267 Ga0495653_0712767
268 Ga0495662_0067890
269 Ga0495606_0000219
270 Ga0495608_0000001
271 Ga0495618_0000003
272 Ga0495628_0002409
273 Ga0495628_0744146
274 Ga0495630_0000141
275 Ga0495630_0002670
276 Ga0495644_0317536
277 Ga0495652_0000003
278 Ga0495587_0284614
279 Ga0495645_0597693
280 Ga0495667_0000057
281 Ga0495634_0000030
282 Ga0495634_0797315
283 Ga0495625_0000154
284 Ga0495635_0000006
285 Ga0495635_0070085
286 Ga0495588_0000195
287 Ga0495588_0292868
288 Ga0495657_0000002
289 Ga0495657_0033098
290 Ga0495624_0153860
291 Ga0495674_0000007
292 Ga0495676_0016789
293 Ga0495680_0000324
294 Ga0495675_0000104
295 Ga0495675_0014125
296 Ga0496100_0000027
297 Ga0496101_0000012
298 Ga0496102_0000850
299 Ga0496102_1078571
300 Ga0496103_0000001
301 Ga0496106_0000020
302 Ga0496107_0000014
303 Ga0496108_0806845
304 Ga0496109_0000035
305 Ga0496109_0238217
306 Ga0496109_1234719
307 Ga0496110_0000850
308 Ga0496111_0000001
309 Ga0496111_0024418
310 Ga0496112_0000231
311 Ga0496113_0000010
312 Ga0496113_0208447
313 Ga0496114_0000043
314 Ga0496114_0111047
315 Ga0496114_0355247
316 Ga0496115_0000004
317 Ga0496115_0000104
318 Ga0496115_0921791
319 Ga0496118_0220583
320 Ga0496124_0368568
321 Ga0501042_0084942
322 Ga0501081_0104191
323 nmdc:mga0n895_1499998_c1
324 nmdc:mga0a205_1126951_c1
325 Ga0495601_0086206
326 Ga0495655_0000590
327 Ga0495595_0000001
328 Ga0495619_0000094
329 Ga0495619_0000819
330 Ga0495619_0023364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map