F245380

General Info

Members Datasets Scaffolds Average Seq Length
165 109 330 201

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100880282|Ga0070670_1008802821
Length 207
Sequence MQALKAELPPESPAGSDPVKRLMERLREERFTTDQTDQEWEEFGEIIFHRGEKISFADGETVFIFTRVDDLDEAILKQTSDSVVHTYKAKNPRQKALSVLQSTTIYHCLVVPGDQPHNEMLSDFVKRQLGATFIPVVIVPEINQVIYPDVEEKVGTFRPRIEYLQYLLGERRTTVNMHKTTKQAMWISLAVLVVLILLIAASLIPHS

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 15.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100880282 3300005331 Unclassified 811
2 MBSR1b_contig_2328740 2162886012 Bacteria 817
3 Ga0065707_10243937 3300005295 Bacteria 1146
4 Ga0070676_10674879 3300005328 Unclassified 752
5 Ga0070683_100000067 3300005329 Bacteria 73813
6 Ga0070683_100341403 3300005329 Unclassified 1426
7 Ga0070670_100001897 3300005331 Bacteria 17086
8 Ga0070670_100066568 3300005331 Bacteria 3091
9 Ga0068869_100001268 3300005334 Bacteria 14937
10 Ga0070680_100212231 3300005336 Unclassified 1633
11 Ga0070682_100000003 3300005337 Bacteria 469319
12 Ga0070682_100138900 3300005337 Bacteria 1654
13 Ga0068868_100001196 3300005338 Bacteria 17821
14 Ga0068868_100001953 3300005338 Bacteria 14148
15 Ga0070689_100031529 3300005340 Bacteria 4029
16 Ga0070689_100726622 3300005340 Bacteria 869
17 Ga0070661_100221909 3300005344 Bacteria 1450
18 Ga0070675_100000020 3300005354 Bacteria 168778
19 Ga0070671_100043786 3300005355 Bacteria 3720
20 Ga0070671_100837180 3300005355 Bacteria 802
21 Ga0070700_100000104 3300005441 Bacteria 53476
22 Ga0070708_100866000 3300005445 Unclassified 849
23 Ga0070678_101108978 3300005456 Bacteria 731
24 Ga0068867_100239881 3300005459 Bacteria 1470
25 Ga0070685_10012375 3300005466 Bacteria 4481
26 Ga0070706_100020825 3300005467 Bacteria 6038
27 Ga0070706_100627421 3300005467 Bacteria 998
28 Ga0070707_100048695 3300005468 Bacteria 4060
29 Ga0070707_100367061 3300005468 Bacteria 1398
30 Ga0070698_100026592 3300005471 Bacteria 6023
31 Ga0070698_100490939 3300005471 Bacteria 1165
32 Ga0070698_100654093 3300005471 Unclassified 992
33 Ga0070699_100034588 3300005518 Bacteria 4367
34 Ga0070699_100103448 3300005518 Unclassified 2497
35 Ga0070699_100274467 3300005518 Unclassified 1509
36 Ga0070684_100001761 3300005535 Bacteria 15796
37 Ga0070684_100354392 3300005535 Bacteria 1350
38 Ga0070697_100028831 3300005536 Bacteria 4447
39 Ga0070697_101043123 3300005536 Bacteria 727
40 Ga0068853_100053981 3300005539 Bacteria 3462
41 Ga0070672_100000242 3300005543 Bacteria 30531
42 Ga0070686_100127229 3300005544 Unclassified 1757
43 Ga0070696_100073704 3300005546 Unclassified 2406
44 Ga0070693_100034042 3300005547 Bacteria 2816
45 Ga0068857_100029700 3300005577 Bacteria 4825
46 Ga0068854_100063943 3300005578 Bacteria 2672
47 Ga0070702_100001866 3300005615 Bacteria 8810
48 Ga0070702_100052152 3300005615 Archaea 2345
49 Ga0070702_100249970 3300005615 Unclassified 1201
50 Ga0068859_100662259 3300005617 Bacteria 1136
51 Ga0068864_100000013 3300005618 Bacteria 326235
52 Ga0068864_100540781 3300005618 Bacteria 1125
53 Ga0068861_100110604 3300005719 Bacteria 2201
54 Ga0068870_10029424 3300005840 Bacteria 2767
55 Ga0068870_10064964 3300005840 Bacteria 1972
56 Ga0068858_100000011 3300005842 Bacteria 233214
57 Ga0070716_100539905 3300006173 Bacteria 867
58 Ga0068871_100411564 3300006358 Unclassified 1206
59 Ga0068871_100423699 3300006358 Bacteria 1189
60 Ga0075428_100091544 3300006844 Bacteria 3317
61 Ga0075428_100512417 3300006844 Bacteria 1283
62 Ga0075431_100012579 3300006847 Bacteria 8541
63 Ga0075433_10535328 3300006852 Bacteria 1030
64 Ga0075434_100210825 3300006871 Bacteria 1963
65 Ga0075429_100063364 3300006880 Bacteria 3221
66 Ga0097620_100662266 3300006931 Bacteria 1136
67 Ga0075435_100000056 3300007076 Bacteria 58362
68 Ga0075435_100119966 3300007076 Unclassified 2194
69 Ga0105240_10005713 3300009093 Bacteria 18456
70 Ga0111539_10000145 3300009094 Bacteria 81751
71 Ga0105245_10000013 3300009098 Bacteria 266248
72 Ga0105245_10002515 3300009098 Bacteria 16530
73 Ga0105245_10003388 3300009098 Bacteria 14275
74 Ga0105245_10117091 3300009098 Bacteria 2485
75 Ga0105245_10391879 3300009098 Bacteria 1386
76 Ga0105242_10015774 3300009176 Bacteria 5869
77 Ga0105248_10211411 3300009177 Bacteria 2186
78 Ga0105238_10000001 3300009551 Bacteria 2036163
79 Ga0105239_10083642 3300010375 Bacteria 3515
80 Ga0105246_10253243 3300011119 Bacteria 1399
81 Ga0157369_10000282 3300013105 Bacteria 68052
82 Ga0157374_10000010 3300013296 Bacteria 505635
83 Ga0157378_10000034 3300013297 Bacteria 120274
84 Ga0157378_10003554 3300013297 Bacteria 13811
85 Ga0157378_10003849 3300013297 Bacteria 13276
86 Ga0157378_10081428 3300013297 Bacteria 2926
87 Ga0163162_10811098 3300013306 Bacteria 1053
88 Ga0157375_10000012 3300013308 Bacteria 330517
89 Ga0157375_10000054 3300013308 Bacteria 126807
90 Ga0157375_10000946 3300013308 Bacteria 25152
91 Ga0163163_10380149 3300014325 Bacteria 1470
92 Ga0157380_10022762 3300014326 Bacteria 4724
93 Ga0157377_10000015 3300014745 Bacteria 190735
94 Ga0157377_10000122 3300014745 Bacteria 50493
95 Ga0157376_10000019 3300014969 Bacteria 255553
96 Ga0213873_10000002 3300021358 Bacteria 1164195
97 Ga0213873_10002560 3300021358 Unclassified 3164
98 Ga0213876_10000001 3300021384 Bacteria 1186326
99 Ga0213876_10000014 3300021384 Bacteria 310412
100 Ga0207699_10267686 3300025906 Bacteria 1183
101 Ga0207645_10168262 3300025907 Bacteria 1435
102 Ga0207684_10094060 3300025910 Unclassified 2556
103 Ga0207695_10024744 3300025913 Bacteria 6742
104 Ga0207695_10871945 3300025913 Unclassified 780
105 Ga0207660_10067241 3300025917 Unclassified 2595
106 Ga0207662_10017662 3300025918 Bacteria 4038
107 Ga0207694_10000001 3300025924 Bacteria 4078485
108 Ga0207650_10001461 3300025925 Bacteria 17006
109 Ga0207650_10013159 3300025925 Bacteria 5727
110 Ga0207650_10572646 3300025925 Unclassified 948
111 Ga0207659_10000035 3300025926 Bacteria 104092
112 Ga0207687_10000014 3300025927 Bacteria 297704
113 Ga0207687_10000301 3300025927 Bacteria 33834
114 Ga0207687_10002093 3300025927 Bacteria 13637
115 Ga0207687_10245815 3300025927 Bacteria 1420
116 Ga0207670_10570384 3300025936 Bacteria 927
117 Ga0207670_10657811 3300025936 Bacteria 864
118 Ga0207691_10000444 3300025940 Bacteria 40991
119 Ga0207689_10026765 3300025942 Bacteria 4830
120 Ga0207661_10000004 3300025944 Bacteria 606391
121 Ga0207661_10269070 3300025944 Unclassified 1520
122 Ga0207661_10676052 3300025944 Bacteria 949
123 Ga0207640_10013420 3300025981 Bacteria 4694
124 Ga0207640_10166181 3300025981 Bacteria 1639
125 Ga0207677_10000002 3300026023 Bacteria 478921
126 Ga0207677_10000122 3300026023 Bacteria 63627
127 Ga0207703_10000004 3300026035 Bacteria 526312
128 Ga0207703_10258956 3300026035 Unclassified 1572
129 Ga0207639_10000006 3300026041 Bacteria 544415
130 Ga0207708_10000012 3300026075 Bacteria 207611
131 Ga0207648_10341059 3300026089 Bacteria 1349
132 Ga0207648_10580383 3300026089 Bacteria 1032
133 Ga0207676_10000030 3300026095 Bacteria 221663
134 Ga0207676_10462832 3300026095 Bacteria 1198
135 Ga0207674_10240020 3300026116 Bacteria 1759
136 Ga0207675_100038322 3300026118 Bacteria 4472
137 Ga0207428_10000209 3300027907 Bacteria 81761
138 Ga0307511_10003097 3300030521 Bacteria 17138
139 Ga0307516_10446994 3300031730 Unclassified 949
140 Ga0436365_0236662 3300039437 Bacteria 205513
141 Ga0436365_0332720 3300039437 Bacteria 227622
142 Ga0436365_0497973 3300039437 Bacteria 1494
143 Ga0436365_0643761 3300039437 Bacteria 10023
144 Ga0436365_1045261 3300039437 Bacteria 943
145 Ga0436363_1260452 3300039450 Bacteria 1635
146 Ga0436362_0660519 3300039453 Bacteria 832172
147 Ga0436362_0958893 3300039453 Bacteria 24381
148 Ga0451837_0080435 3300041494 Bacteria 712
149 Ga0453683_0059432 3300044673 Unclassified 2390
150 Ga0495620_0025845 3300046515 Bacteria 2770
151 Ga0495621_0041259 3300046539 Bacteria 1620
152 Ga0495679_038669 3300047446 Bacteria 1493
153 Ga0496106_0179360 3300048909 Bacteria 1681
154 Ga0501073_0029756 3300049589 Bacteria 3903
155 Ga0501080_0002179 3300049742 Bacteria 17010
156 nmdc:mga05p37_157786_c1 3300050507 Unclassified 2772
157 nmdc:mga06r32_115020_c1 3300050510 Bacteria 2649
158 nmdc:mga08y16_80_c1 3300050511 Bacteria 81759
159 nmdc:mga0n895_1323088_c1 3300050512 Bacteria 691
160 nmdc:mga0n895_292297_c1 3300050512 Bacteria 1652
161 nmdc:mga0rr50_350196_c1 3300050513 Unclassified 1242
162 nmdc:mga0rr50_40_c1 3300050513 Bacteria 83054
163 nmdc:mga0rr50_4336_c1 3300050513 Bacteria 8320
164 nmdc:mga0a205_405367_c1 3300050515 Unclassified 1227
165 Ga0495655_0091741 3300053083 Bacteria 886
166 Ga0070670_100880282
167 MBSR1b_contig_2328740
168 Ga0065707_10243937
169 Ga0070676_10674879
170 Ga0070683_100000067
171 Ga0070683_100341403
172 Ga0070670_100001897
173 Ga0070670_100066568
174 Ga0068869_100001268
175 Ga0070680_100212231
176 Ga0070682_100000003
177 Ga0070682_100138900
178 Ga0068868_100001196
179 Ga0068868_100001953
180 Ga0070689_100031529
181 Ga0070689_100726622
182 Ga0070661_100221909
183 Ga0070675_100000020
184 Ga0070671_100043786
185 Ga0070671_100837180
186 Ga0070700_100000104
187 Ga0070708_100866000
188 Ga0070678_101108978
189 Ga0068867_100239881
190 Ga0070685_10012375
191 Ga0070706_100020825
192 Ga0070706_100627421
193 Ga0070707_100048695
194 Ga0070707_100367061
195 Ga0070698_100026592
196 Ga0070698_100490939
197 Ga0070698_100654093
198 Ga0070699_100034588
199 Ga0070699_100103448
200 Ga0070699_100274467
201 Ga0070684_100001761
202 Ga0070684_100354392
203 Ga0070697_100028831
204 Ga0070697_101043123
205 Ga0068853_100053981
206 Ga0070672_100000242
207 Ga0070686_100127229
208 Ga0070696_100073704
209 Ga0070693_100034042
210 Ga0068857_100029700
211 Ga0068854_100063943
212 Ga0070702_100001866
213 Ga0070702_100052152
214 Ga0070702_100249970
215 Ga0068859_100662259
216 Ga0068864_100000013
217 Ga0068864_100540781
218 Ga0068861_100110604
219 Ga0068870_10029424
220 Ga0068870_10064964
221 Ga0068858_100000011
222 Ga0070716_100539905
223 Ga0068871_100411564
224 Ga0068871_100423699
225 Ga0075428_100091544
226 Ga0075428_100512417
227 Ga0075431_100012579
228 Ga0075433_10535328
229 Ga0075434_100210825
230 Ga0075429_100063364
231 Ga0097620_100662266
232 Ga0075435_100000056
233 Ga0075435_100119966
234 Ga0105240_10005713
235 Ga0111539_10000145
236 Ga0105245_10000013
237 Ga0105245_10002515
238 Ga0105245_10003388
239 Ga0105245_10117091
240 Ga0105245_10391879
241 Ga0105242_10015774
242 Ga0105248_10211411
243 Ga0105238_10000001
244 Ga0105239_10083642
245 Ga0105246_10253243
246 Ga0157369_10000282
247 Ga0157374_10000010
248 Ga0157378_10000034
249 Ga0157378_10003554
250 Ga0157378_10003849
251 Ga0157378_10081428
252 Ga0163162_10811098
253 Ga0157375_10000012
254 Ga0157375_10000054
255 Ga0157375_10000946
256 Ga0163163_10380149
257 Ga0157380_10022762
258 Ga0157377_10000015
259 Ga0157377_10000122
260 Ga0157376_10000019
261 Ga0213873_10000002
262 Ga0213873_10002560
263 Ga0213876_10000001
264 Ga0213876_10000014
265 Ga0207699_10267686
266 Ga0207645_10168262
267 Ga0207684_10094060
268 Ga0207695_10024744
269 Ga0207695_10871945
270 Ga0207660_10067241
271 Ga0207662_10017662
272 Ga0207694_10000001
273 Ga0207650_10001461
274 Ga0207650_10013159
275 Ga0207650_10572646
276 Ga0207659_10000035
277 Ga0207687_10000014
278 Ga0207687_10000301
279 Ga0207687_10002093
280 Ga0207687_10245815
281 Ga0207670_10570384
282 Ga0207670_10657811
283 Ga0207691_10000444
284 Ga0207689_10026765
285 Ga0207661_10000004
286 Ga0207661_10269070
287 Ga0207661_10676052
288 Ga0207640_10013420
289 Ga0207640_10166181
290 Ga0207677_10000002
291 Ga0207677_10000122
292 Ga0207703_10000004
293 Ga0207703_10258956
294 Ga0207639_10000006
295 Ga0207708_10000012
296 Ga0207648_10341059
297 Ga0207648_10580383
298 Ga0207676_10000030
299 Ga0207676_10462832
300 Ga0207674_10240020
301 Ga0207675_100038322
302 Ga0207428_10000209
303 Ga0307511_10003097
304 Ga0307516_10446994
305 Ga0436365_0236662
306 Ga0436365_0332720
307 Ga0436365_0497973
308 Ga0436365_0643761
309 Ga0436365_1045261
310 Ga0436363_1260452
311 Ga0436362_0660519
312 Ga0436362_0958893
313 Ga0451837_0080435
314 Ga0453683_0059432
315 Ga0495620_0025845
316 Ga0495621_0041259
317 Ga0495679_038669
318 Ga0496106_0179360
319 Ga0501073_0029756
320 Ga0501080_0002179
321 nmdc:mga05p37_157786_c1
322 nmdc:mga06r32_115020_c1
323 nmdc:mga08y16_80_c1
324 nmdc:mga0n895_1323088_c1
325 nmdc:mga0n895_292297_c1
326 nmdc:mga0rr50_350196_c1
327 nmdc:mga0rr50_40_c1
328 nmdc:mga0rr50_4336_c1
329 nmdc:mga0a205_405367_c1
330 Ga0495655_0091741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qrd-assembly3.cif.gz_B crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and atp 0.6382 31 66
2qr1-assembly1.cif.gz_B crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp 0.6365 31 66
3mpr-assembly2.cif.gz_D crystal structure of endonuclease/exonuclease/phosphatase family protein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr318a 0.5387 45 86
1rqq-assembly1.cif.gz_D crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps 0.5236 136 171
5w3y-assembly4.cif.gz_D crystal structure of popp2 c321a in complex with ip6 and accoa 0.5232 46 118
ID Description Score Start End Superfamily
4qfrB02 Special;Other non-globular;Double Stranded RNA Binding Domain; 0.6921 31 66 6.20.250.60
af_Q682V0_22_133_2.170.210.10 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal 0.6571 31 66 2.170.210.10
af_D4A3B6_1_93_2.40.15.10 Mainly Beta;Beta Barrel;Proto-oncogene - Oncogene Product P14tcl1;TCL1/MTCP1 0.6535 42 63 2.40.15.10
2qrdB01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.6382 31 66 2.20.25.290
1syoB02 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.5996 45 73 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A2V7WMA3-F1-model_v4 Uncharacterized protein 0.8505 1 199 GO:0016020
AF-A0A2V7WMA3-F1-model_v4 Uncharacterized protein 0.8464 1 199 GO:0016020
AF-A0A1F8MA87-F1-model_v4 Uncharacterized protein 0.6937 18 168
AF-A0A7X7VDV2-F1-model_v4 DZANK-type domain-containing protein 0.6921 18 168
AF-A0A348ZYV7-F1-model_v4 DZANK-type domain-containing protein 0.6884 18 172

Map