F246346

General Info

Members Datasets Scaffolds Average Seq Length
165 136 165 298

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10172063|Ga0207665_101720632
Length 334
Sequence VPGLRYPYGGLITGTSSARRWGERGQGTVEWVGLIAVVALMLAALVAAGARLPGADLARAVASRILCAASLADGCGDEPTLIATYGTEVGKLVRRHMPTLLFERGARALPVDFRRCRVVSCGDGTPRGLVHKTDEGMHVTAFVHVVDCREGGDGAGAGGGTLDGDPPNCSGGRAGRLYIQYWTYYADSATLRGVPIAGDAGYHRDDWEGVQIRVGPDGQVDERASSHDGYNYSQSVANAGSDAGIGLLRGAAEAVGARPANGWGPETRLLLVSGGSHAGNTGGYPRIDRVTPGRRVHLVPLEPIAATDGDFYRFAISPPWRKRVWRDPEASGTD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
44 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
45 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 6.67
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100002179 3300005329 Bacteria 15491
2 Ga0070683_100022206 3300005329 Bacteria 5668
3 Ga0070683_100054368 3300005329 Bacteria 3713
4 Ga0070683_100087331 3300005329 Bacteria 2925
5 Ga0070683_100344659 3300005329 Unclassified 1419
6 Ga0070666_10014783 3300005335 Bacteria 4974
7 Ga0070666_10026589 3300005335 Bacteria 3783
8 Ga0070682_100000028 3300005337 Bacteria 185177
9 Ga0070691_10001403 3300005341 Bacteria 10287
10 Ga0070675_100000058 3300005354 Bacteria 66874
11 Ga0070674_100000072 3300005356 Bacteria 46741
12 Ga0070667_100009826 3300005367 Bacteria 7931
13 Ga0070713_100001904 3300005436 Bacteria 13443
14 Ga0070663_100001987 3300005455 Bacteria 11414
15 Ga0070678_100024054 3300005456 Bacteria 4071
16 Ga0070681_10174126 3300005458 Unclassified 2074
17 Ga0068867_100006377 3300005459 Bacteria 8340
18 Ga0070679_100003123 3300005530 Bacteria 15146
19 Ga0070684_100083344 3300005535 Bacteria 2833
20 Ga0070684_100126154 3300005535 Bacteria 2305
21 Ga0070672_100000004 3300005543 Bacteria 129970
22 Ga0070665_100005634 3300005548 Bacteria 12874
23 Ga0070665_100042642 3300005548 Bacteria 4561
24 Ga0070665_100173459 3300005548 Unclassified 2157
25 Ga0068857_100124166 3300005577 Bacteria 2326
26 Ga0068856_100371079 3300005614 Bacteria 1450
27 Ga0068866_10007892 3300005718 Bacteria 4467
28 Ga0081455_10013080 3300005937 Bacteria 8226
29 Ga0070712_100011989 3300006175 Bacteria 5509
30 Ga0157374_10018932 3300013296 Bacteria 6088
31 Ga0157378_10003055 3300013297 Bacteria 14877
32 Ga0157375_10479319 3300013308 Bacteria 1409
33 Ga0157379_10284879 3300014968 Unclassified 1504
34 Ga0207642_10004562 3300025899 Bacteria 4473
35 Ga0207680_10007705 3300025903 Bacteria 5263
36 Ga0207680_10046498 3300025903 Bacteria 2566
37 Ga0207707_10295623 3300025912 Unclassified 1401
38 Ga0207693_10009205 3300025915 Bacteria 8062
39 Ga0207652_10002646 3300025921 Bacteria 15031
40 Ga0207659_10000020 3300025926 Bacteria 151552
41 Ga0207669_10000087 3300025937 Bacteria 46794
42 Ga0207665_10172063 3300025939 Bacteria 1565
43 Ga0207691_10000020 3300025940 Bacteria 133465
44 Ga0207661_10002063 3300025944 Bacteria 13830
45 Ga0207661_10005666 3300025944 Bacteria 8811
46 Ga0207661_10165926 3300025944 Bacteria 1919
47 Ga0207658_10045793 3300025986 Bacteria 3190
48 Ga0207678_10003121 3300026067 Bacteria 14999
49 Ga0207702_10264051 3300026078 Bacteria 1622
50 Ga0207648_10000931 3300026089 Bacteria 32948
51 Ga0207674_10152017 3300026116 Bacteria 2271
52 Ga0207683_10006441 3300026121 Bacteria 10056
53 Ga0268266_10000553 3300028379 Bacteria 52199
54 Ga0268266_10005194 3300028379 Bacteria 12259
55 Ga0265337_1000002 3300028556 Bacteria 139247
56 Ga0265326_10000007 3300028558 Bacteria 223057
57 Ga0265322_10000001 3300028654 Bacteria 543854
58 Ga0265336_10001375 3300028666 Bacteria 11232
59 Ga0265338_10160908 3300028800 Bacteria 1734
60 Ga0265324_10000263 3300029957 Bacteria 39080
61 Ga0265332_10018056 3300031238 Bacteria 3110
62 Ga0265328_10015653 3300031239 Bacteria 2966
63 Ga0265320_10000002 3300031240 Bacteria 542875
64 Ga0265331_10002898 3300031250 Bacteria 11337
65 Ga0265327_10000011 3300031251 Bacteria 543807
66 Ga0265316_10012769 3300031344 Bacteria 7505
67 Ga0265314_10000058 3300031711 Bacteria 167476
68 Ga0307415_100007046 3300032126 Bacteria 6116
69 Ga0373937_0082748 3300036401 Bacteria 2970
70 Ga0451833_1415406 3300041491 Bacteria 1669
71 Ga0466957_0003913 3300044842 Bacteria 8239
72 Ga0495592_0165130 3300046454 Bacteria 1520
73 Ga0495603_0000023 3300046455 Bacteria 63559
74 Ga0495629_0000218 3300046459 Bacteria 51219
75 Ga0495629_0162714 3300046459 Bacteria 1550
76 Ga0495641_0015833 3300046461 Bacteria 3999
77 Ga0495606_0000211 3300046507 Bacteria 103386
78 Ga0495610_0042442 3300046512 Bacteria 2275
79 Ga0495628_0000323 3300046516 Bacteria 43212
80 Ga0495628_0100555 3300046516 Bacteria 2232
81 Ga0495630_0006892 3300046517 Bacteria 8103
82 Ga0495644_0012318 3300046523 Bacteria 3289
83 Ga0495652_0024615 3300046529 Bacteria 5326
84 Ga0495586_0000871 3300046535 Bacteria 17305
85 Ga0495645_0115549 3300046543 Bacteria 1895
86 Ga0495667_0000075 3300046559 Bacteria 73540
87 Ga0495656_0000581 3300046615 Bacteria 11854
88 Ga0495634_0003347 3300046642 Bacteria 12880
89 Ga0495635_0150981 3300046663 Bacteria 1582
90 Ga0495647_0000007 3300046681 Bacteria 103790
91 Ga0495613_0000352 3300046689 Bacteria 40662
92 Ga0495624_0000009 3300046690 Bacteria 145026
93 Ga0495604_0000073 3300047317 Bacteria 86844
94 Ga0495674_0000042 3300047319 Bacteria 94820
95 Ga0495680_0003091 3300047322 Bacteria 16592
96 Ga0495686_0251151 3300047472 Bacteria 994
97 Ga0495593_0075681 3300047673 Bacteria 1745
98 Ga0496100_0208820 3300048903 Unclassified 1427
99 Ga0496103_0066961 3300048906 Bacteria 2242
100 Ga0496104_0163408 3300048907 Bacteria 2135
101 Ga0496105_0001456 3300048908 Bacteria 16668
102 Ga0496108_0013396 3300048911 Bacteria 6688
103 Ga0496109_0143411 3300048912 Bacteria 2234
104 Ga0496110_0080530 3300048913 Bacteria 2902
105 Ga0496111_0078765 3300048914 Bacteria 2403
106 Ga0496113_0070209 3300048916 Bacteria 2662
107 Ga0496114_0007478 3300048917 Bacteria 8638
108 Ga0496115_0070306 3300048918 Bacteria 2837
109 Ga0496117_0001154 3300048920 Bacteria 39767
110 Ga0496118_0002138 3300048921 Bacteria 27578
111 Ga0496119_0007031 3300048922 Bacteria 10243
112 Ga0496119_0007563 3300048922 Bacteria 9754
113 Ga0496119_0022882 3300048922 Bacteria 4453
114 Ga0496120_0001229 3300048923 Bacteria 32395
115 Ga0496121_0008178 3300048924 Bacteria 12420
116 Ga0496121_0017908 3300048924 Bacteria 7188
117 Ga0496121_0173438 3300048924 Bacteria 1564
118 Ga0496124_0054942 3300048927 Bacteria 3368
119 Ga0496125_0059122 3300048928 Bacteria 3091
120 Ga0496126_0009557 3300048929 Bacteria 10288
121 Ga0496126_0069380 3300048929 Bacteria 3144
122 Ga0501031_0019392 3300049568 Bacteria 4431
123 Ga0501032_0013167 3300049569 Bacteria 5886
124 Ga0501033_0003746 3300049570 Bacteria 12360
125 Ga0501034_0026520 3300049571 Bacteria 5901
126 Ga0501034_0160959 3300049571 Bacteria 2216
127 Ga0501036_0027858 3300049572 Bacteria 4776
128 Ga0501037_0019954 3300049573 Bacteria 4946
129 Ga0501038_0030375 3300049574 Bacteria 4782
130 Ga0501039_0041341 3300049575 Bacteria 3560
131 Ga0501040_0023742 3300049576 Bacteria 4112
132 Ga0501042_0040825 3300049578 Bacteria 3298
133 Ga0501042_0092698 3300049578 Bacteria 2169
134 Ga0501043_0024683 3300049579 Bacteria 4713
135 Ga0501046_0028571 3300049580 Bacteria 4540
136 Ga0501047_0000263 3300049581 Bacteria 61685
137 Ga0501047_0009009 3300049581 Bacteria 9424
138 Ga0501047_0323552 3300049581 Bacteria 1381
139 Ga0501048_0023730 3300049582 Bacteria 4478
140 Ga0501048_0294095 3300049582 Bacteria 1155
141 Ga0501067_0090353 3300049583 Bacteria 1700
142 Ga0501068_0023295 3300049584 Bacteria 3626
143 Ga0501069_0007917 3300049585 Bacteria 5581
144 Ga0501069_0024139 3300049585 Bacteria 3317
145 Ga0501070_0013807 3300049586 Bacteria 6804
146 Ga0501070_0022244 3300049586 Bacteria 5311
147 Ga0501073_0023494 3300049589 Bacteria 4426
148 Ga0501074_0097270 3300049590 Bacteria 2107
149 Ga0501076_0141757 3300049592 Bacteria 1953
150 Ga0501076_0310636 3300049592 Bacteria 1293
151 Ga0501079_0026627 3300049741 Bacteria 4433
152 Ga0501080_0043858 3300049742 Bacteria 4164
153 Ga0501080_0172656 3300049742 Bacteria 1993
154 Ga0501081_0048078 3300049743 Bacteria 2936
155 Ga0501083_0020801 3300049744 Bacteria 4562
156 Ga0501035_0056754 3300049822 Bacteria 3492
157 Ga0501044_0006797 3300049823 Bacteria 12605
158 Ga0501044_0372159 3300049823 Bacteria 1345
159 Ga0495612_0005002 3300053078 Bacteria 5490
160 Ga0495655_0001108 3300053083 Bacteria 4178
161 Ga0495619_0003683 3300053085 Bacteria 9877
162 Ga0500566_0007069 3300053094 Bacteria 6646
163 Ga0500650_0066786 3300053098 Unclassified 1680
164 Ga0501084_0249591 3300054114 Bacteria 1498
165 Ga0501082_0044967 3300060353 Bacteria 3808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0141757 Ga0501076_0141757_225_965 231
2 3300053094 Ga0500566_0007069 Ga0500566_0007069_264_1052 234
3 3300046535 Ga0495586_0000871 Ga0495586_0000871_1441_2325 246
4 3300041491 Ga0451833_1415406 Ga0451833_1415406_170_1057 249
5 3300036401 Ga0373937_0082748 Ga0373937_0082748_1601_2395 251
6 3300046523 Ga0495644_0012318 Ga0495644_0012318_2271_3167 259
7 3300053085 Ga0495619_0003683 Ga0495619_0003683_7686_8507 260
8 3300046517 Ga0495630_0006892 Ga0495630_0006892_5313_6242 261
9 3300028556 Ga0265337_1000002 Ga0265337_1000002117 264
10 3300028558 Ga0265326_10000007 Ga0265326_10000007175 264
11 3300028654 Ga0265322_10000001 Ga0265322_10000001128 264
12 3300028666 Ga0265336_10001375 Ga0265336_100013759 264
13 3300028800 Ga0265338_10160908 Ga0265338_101609082 264
14 3300029957 Ga0265324_10000263 Ga0265324_100002639 264
15 3300031238 Ga0265332_10018056 Ga0265332_100180562 264
16 3300031239 Ga0265328_10015653 Ga0265328_100156532 264
17 3300031240 Ga0265320_10000002 Ga0265320_10000002128 264
18 3300031250 Ga0265331_10002898 Ga0265331_1000289811 264
19 3300031251 Ga0265327_10000011 Ga0265327_10000011128 264
20 3300031344 Ga0265316_10012769 Ga0265316_100127692 264
21 3300031711 Ga0265314_10000058 Ga0265314_1000005835 264
22 3300048911 Ga0496108_0013396 Ga0496108_0013396_2644_3534 270
23 3300048912 Ga0496109_0143411 Ga0496109_0143411_1271_2161 270
24 3300048916 Ga0496113_0070209 Ga0496113_0070209_80_970 270
25 3300048917 Ga0496114_0007478 Ga0496114_0007478_6564_7430 272
26 3300048918 Ga0496115_0070306 Ga0496115_0070306_524_1447 272
27 3300046507 Ga0495606_0000211 Ga0495606_0000211_41184_42068 273
28 3300005341 Ga0070691_10001403 Ga0070691_100014034 274
29 3300005548 Ga0070665_100005634 Ga0070665_1000056343 275
30 3300028379 Ga0268266_10000553 Ga0268266_1000055352 275
31 3300046455 Ga0495603_0000023 Ga0495603_0000023_18163_19086 275
32 3300046615 Ga0495656_0000581 Ga0495656_0000581_4371_5273 275
33 3300049578 Ga0501042_0092698 Ga0501042_0092698_859_1731 275
34 3300025944 Ga0207661_10165926 Ga0207661_101659262 276
35 3300046690 Ga0495624_0000009 Ga0495624_0000009_25610_26539 276
36 3300049582 Ga0501048_0294095 Ga0501048_0294095_137_1051 276
37 3300049592 Ga0501076_0310636 Ga0501076_0310636_337_1251 276
38 3300005329 Ga0070683_100022206 Ga0070683_1000222063 278
39 3300005335 Ga0070666_10014783 Ga0070666_100147833 278
40 3300005367 Ga0070667_100009826 Ga0070667_1000098262 278
41 3300005535 Ga0070684_100083344 Ga0070684_1000833442 278
42 3300005548 Ga0070665_100042642 Ga0070665_1000426424 278
43 3300006175 Ga0070712_100011989 Ga0070712_1000119895 278
44 3300025903 Ga0207680_10007705 Ga0207680_100077054 278
45 3300025915 Ga0207693_10009205 Ga0207693_100092055 278
46 3300025944 Ga0207661_10005666 Ga0207661_100056665 278
47 3300025986 Ga0207658_10045793 Ga0207658_100457933 278
48 3300028379 Ga0268266_10005194 Ga0268266_100051943 278
49 3300046461 Ga0495641_0015833 Ga0495641_0015833_1638_2549 278
50 3300046516 Ga0495628_0000323 Ga0495628_0000323_22434_23315 278
51 3300046516 Ga0495628_0100555 Ga0495628_0100555_1163_2074 278
52 3300046529 Ga0495652_0024615 Ga0495652_0024615_2517_3428 278
53 3300049743 Ga0501081_0048078 Ga0501081_0048078_1059_1979 278
54 3300046543 Ga0495645_0115549 Ga0495645_0115549_289_1200 279
55 3300005577 Ga0068857_100124166 Ga0068857_1001241662 280
56 3300026116 Ga0207674_10152017 Ga0207674_101520173 280
57 3300046454 Ga0495592_0165130 Ga0495592_0165130_489_1415 281
58 3300005329 Ga0070683_100344659 Ga0070683_1003446592 282
59 3300005335 Ga0070666_10026589 Ga0070666_100265893 282
60 3300025903 Ga0207680_10046498 Ga0207680_100464982 282
61 3300046559 Ga0495667_0000075 Ga0495667_0000075_38536_39459 282
62 3300047322 Ga0495680_0003091 Ga0495680_0003091_2745_3668 282
63 3300053078 Ga0495612_0005002 Ga0495612_0005002_4016_4909 282
64 3300048913 Ga0496110_0080530 Ga0496110_0080530_1094_2008 283
65 3300048922 Ga0496119_0007563 Ga0496119_0007563_94_990 283
66 3300048924 Ga0496121_0173438 Ga0496121_0173438_617_1513 283
67 3300048927 Ga0496124_0054942 Ga0496124_0054942_1015_1911 283
68 3300048929 Ga0496126_0069380 Ga0496126_0069380_1324_2220 283
69 3300049586 Ga0501070_0013807 Ga0501070_0013807_2248_3144 283
70 3300053098 Ga0500650_0066786 Ga0500650_0066786_18_914 283
71 3300005543 Ga0070672_100000004 Ga0070672_100000004103 285
72 3300025940 Ga0207691_10000020 Ga0207691_1000002023 285
73 3300047673 Ga0495593_0075681 Ga0495593_0075681_316_1239 285
74 3300049590 Ga0501074_0097270 Ga0501074_0097270_1115_2038 286
75 3300046459 Ga0495629_0162714 Ga0495629_0162714_424_1335 290
76 3300005329 Ga0070683_100054368 Ga0070683_1000543682 291
77 3300005436 Ga0070713_100001904 Ga0070713_1000019046 291
78 3300044842 Ga0466957_0003913 Ga0466957_0003913_2934_3848 291
79 3300046459 Ga0495629_0000218 Ga0495629_0000218_42647_43531 291
80 3300047317 Ga0495604_0000073 Ga0495604_0000073_9593_10513 291
81 3300047319 Ga0495674_0000042 Ga0495674_0000042_33949_34860 291
82 3300005329 Ga0070683_100002179 Ga0070683_1000021794 292
83 3300005329 Ga0070683_100087331 Ga0070683_1000873314 292
84 3300005337 Ga0070682_100000028 Ga0070682_10000002829 292
85 3300005354 Ga0070675_100000058 Ga0070675_10000005868 292
86 3300005356 Ga0070674_100000072 Ga0070674_10000007242 292
87 3300005455 Ga0070663_100001987 Ga0070663_1000019876 292
88 3300005456 Ga0070678_100024054 Ga0070678_1000240542 292
89 3300005458 Ga0070681_10174126 Ga0070681_101741261 292
90 3300005459 Ga0068867_100006377 Ga0068867_1000063772 292
91 3300005530 Ga0070679_100003123 Ga0070679_1000031237 292
92 3300005535 Ga0070684_100126154 Ga0070684_1001261542 292
93 3300005548 Ga0070665_100173459 Ga0070665_1001734592 292
94 3300005614 Ga0068856_100371079 Ga0068856_1003710792 292
95 3300005718 Ga0068866_10007892 Ga0068866_100078921 292
96 3300005937 Ga0081455_10013080 Ga0081455_100130807 292
97 3300013296 Ga0157374_10018932 Ga0157374_100189322 292
98 3300013297 Ga0157378_10003055 Ga0157378_100030554 292
99 3300013308 Ga0157375_10479319 Ga0157375_104793191 292
100 3300014968 Ga0157379_10284879 Ga0157379_102848792 292
101 3300025899 Ga0207642_10004562 Ga0207642_100045626 292
102 3300025912 Ga0207707_10295623 Ga0207707_102956232 292
103 3300025921 Ga0207652_10002646 Ga0207652_100026467 292
104 3300025926 Ga0207659_10000020 Ga0207659_1000002038 292
105 3300025937 Ga0207669_10000087 Ga0207669_1000008743 292
106 3300025939 Ga0207665_10172063 Ga0207665_101720632 292
107 3300025944 Ga0207661_10002063 Ga0207661_1000206312 292
108 3300026067 Ga0207678_10003121 Ga0207678_100031217 292
109 3300026078 Ga0207702_10264051 Ga0207702_102640512 292
110 3300026089 Ga0207648_10000931 Ga0207648_1000093116 292
111 3300026121 Ga0207683_10006441 Ga0207683_100064414 292
112 3300032126 Ga0307415_100007046 Ga0307415_1000070464 292
113 3300046512 Ga0495610_0042442 Ga0495610_0042442_324_1211 292
114 3300046642 Ga0495634_0003347 Ga0495634_0003347_1352_2278 292
115 3300046663 Ga0495635_0150981 Ga0495635_0150981_385_1305 292
116 3300046681 Ga0495647_0000007 Ga0495647_0000007_85645_86571 292
117 3300046689 Ga0495613_0000352 Ga0495613_0000352_2662_3585 292
118 3300047472 Ga0495686_0251151 Ga0495686_0251151_56_979 292
119 3300048903 Ga0496100_0208820 Ga0496100_0208820_134_1057 292
120 3300048906 Ga0496103_0066961 Ga0496103_0066961_173_1096 292
121 3300048907 Ga0496104_0163408 Ga0496104_0163408_131_1054 292
122 3300048908 Ga0496105_0001456 Ga0496105_0001456_1808_2731 292
123 3300048914 Ga0496111_0078765 Ga0496111_0078765_1098_2012 292
124 3300048920 Ga0496117_0001154 Ga0496117_0001154_5414_6337 292
125 3300048921 Ga0496118_0002138 Ga0496118_0002138_16047_16970 292
126 3300048922 Ga0496119_0007031 Ga0496119_0007031_1077_2000 292
127 3300048922 Ga0496119_0022882 Ga0496119_0022882_220_1143 292
128 3300048923 Ga0496120_0001229 Ga0496120_0001229_12690_13613 292
129 3300048924 Ga0496121_0008178 Ga0496121_0008178_2281_3204 292
130 3300048924 Ga0496121_0017908 Ga0496121_0017908_5174_6097 292
131 3300048928 Ga0496125_0059122 Ga0496125_0059122_307_1230 292
132 3300048929 Ga0496126_0009557 Ga0496126_0009557_6385_7308 292
133 3300049568 Ga0501031_0019392 Ga0501031_0019392_2326_3249 292
134 3300049569 Ga0501032_0013167 Ga0501032_0013167_3681_4604 292
135 3300049570 Ga0501033_0003746 Ga0501033_0003746_2437_3360 292
136 3300049571 Ga0501034_0026520 Ga0501034_0026520_1211_2134 292
137 3300049571 Ga0501034_0160959 Ga0501034_0160959_584_1507 292
138 3300049572 Ga0501036_0027858 Ga0501036_0027858_2598_3521 292
139 3300049573 Ga0501037_0019954 Ga0501037_0019954_1591_2514 292
140 3300049574 Ga0501038_0030375 Ga0501038_0030375_2431_3354 292
141 3300049575 Ga0501039_0041341 Ga0501039_0041341_2333_3256 292
142 3300049576 Ga0501040_0023742 Ga0501040_0023742_979_1902 292
143 3300049578 Ga0501042_0040825 Ga0501042_0040825_1732_2655 292
144 3300049579 Ga0501043_0024683 Ga0501043_0024683_1403_2326 292
145 3300049580 Ga0501046_0028571 Ga0501046_0028571_2407_3330 292
146 3300049581 Ga0501047_0000263 Ga0501047_0000263_51579_52502 292
147 3300049581 Ga0501047_0009009 Ga0501047_0009009_1228_2151 292
148 3300049581 Ga0501047_0323552 Ga0501047_0323552_270_1193 292
149 3300049582 Ga0501048_0023730 Ga0501048_0023730_2371_3294 292
150 3300049583 Ga0501067_0090353 Ga0501067_0090353_320_1243 292
151 3300049584 Ga0501068_0023295 Ga0501068_0023295_306_1229 292
152 3300049585 Ga0501069_0007917 Ga0501069_0007917_1642_2571 292
153 3300049585 Ga0501069_0024139 Ga0501069_0024139_299_1222 292
154 3300049586 Ga0501070_0022244 Ga0501070_0022244_2488_3411 292
155 3300049589 Ga0501073_0023494 Ga0501073_0023494_2294_3217 292
156 3300049741 Ga0501079_0026627 Ga0501079_0026627_1107_2030 292
157 3300049742 Ga0501080_0043858 Ga0501080_0043858_2290_3213 292
158 3300049742 Ga0501080_0172656 Ga0501080_0172656_346_1269 292
159 3300049744 Ga0501083_0020801 Ga0501083_0020801_1305_2228 292
160 3300049822 Ga0501035_0056754 Ga0501035_0056754_1211_2134 292
161 3300049823 Ga0501044_0006797 Ga0501044_0006797_9184_10107 292
162 3300049823 Ga0501044_0372159 Ga0501044_0372159_195_1118 292
163 3300053083 Ga0495655_0001108 Ga0495655_0001108_72_995 292
164 3300054114 Ga0501084_0249591 Ga0501084_0249591_268_1191 292
165 3300060353 Ga0501082_0044967 Ga0501082_0044967_1270_2193 292

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w1w-assembly5.cif.gz_A sc smc1hd:scc1-c complex, atpgs 0.7084 146 195
6zz6-assembly1.cif.gz_A cryo-em structure of s.cerevisiae cohesin-scc2-dna complex 0.6929 146 195
2gdq-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6695 150 198
3bjs-assembly1.cif.gz_B crystal structure of a member of enolase superfamily from polaromonas sp. js666 0.6239 152 198
6qpq-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6032 147 203
ID Description Score Start End Superfamily
1w1wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7084 146 195 3.40.50.300
2ggeB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6775 150 198 3.30.390.10
af_Q9LFS8_23_178_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6443 144 194 3.40.50.300
af_A0A1D6GTS1_30_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6413 144 194 3.40.50.300
3bjsB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6328 152 198 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A538EDM8-F1-model_v4 DUF946 domain-containing protein 0.7144 58 288
AF-A0A835ZEL0-F1-model_v4 Uncharacterized protein 0.709 121 200
AF-A0A538A6K2-F1-model_v4 DUF946 domain-containing protein 0.6931 6 291 GO:0016020
AF-A0A7J9YNW6-F1-model_v4 DUF946 domain-containing protein 0.6826 4 291
AF-A0A538A6K2-F1-model_v4 DUF946 domain-containing protein 0.6778 6 291 GO:0016020

Feature Viewer

pLDDT pTM Quality
73.7 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map