F246451

General Info

Members Datasets Scaffolds Average Seq Length
165 123 332 171

Family's Representative Sequence

Representative Sequence 3300030732|Ga0316176_1025862|Ga0316176_10258623
Length 174
Sequence MGHKDSYDDSEKIPNWKSDFPFQAKKATHVGRREFAKFLALFSGALAVTNGAIVIRSLSFPTKPLEGEHFICNEDDIEVGKMFQFEIHGSKHIPYILIHLKEGEWRAFEQKCTHLTCAVRYREDLQKIECPCHHGFFSPDTGEVLQGPPPRPLPQLKVVVRDGKVFVKEKTENT

Samples

Sample ID Description Type Environment
1 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
37 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
69 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
75 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
87 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
88 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
91 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
92 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
97 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
98 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
99 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
100 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
101 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
102 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
103 2738541278 Niastella sp. CF465 Isolate Unclassified
104 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
105 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
106 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
107 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
108 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
109 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
110 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
111 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
112 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
113 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
114 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
115 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
116 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
117 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
118 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
119 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
120 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
121 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
122 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
123 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.85
Metatranscriptomes 0
Isolates 15.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 0.61
Rhizosphere 75.15
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316176_1025862 3300030732 Bacteria 8842
2 JGI24740J21852_10016211 3300001979 Bacteria 2698
3 JGI24740J21852_10099935 3300001979 Bacteria 739
4 JGI25154J39366_1000044 3300002738 Bacteria 136516
5 JGI25158J39367_1008629 3300002739 Bacteria 1412
6 JGI25157J39369_1005701 3300002741 Bacteria 1986
7 JGI25153J46596_10002544 3300003215 Bacteria 10452
8 rootH2_10009120 3300003320 Bacteria 6097
9 rootH2_10069246 3300003320 Bacteria 20061
10 rootL2_10037395 3300003322 Bacteria 9152
11 rootL2_10171967 3300003322 Bacteria 4068
12 rootH1_10012226 3300003316 Bacteria 1969
13 rootH1_10012226 3300003323 Bacteria 4225
14 rootH1_10056421 3300003316 Bacteria 3931
15 rootH1_10056421 3300003323 Bacteria 19846
16 rootH1_10322879 3300003323 Bacteria 1019
17 JGI25160J50197_1008490 3300003354 Bacteria 3909
18 JGI25160J50197_1008963 3300003354 Bacteria 3759
19 Ga0065165_1016784 3300005262 Bacteria 2726
20 Ga0065715_10090107 3300005293 Bacteria 7657
21 Ga0070658_10168264 3300005327 Bacteria 1841
22 Ga0070690_100467444 3300005330 Bacteria 938
23 Ga0070670_100929751 3300005331 Bacteria 789
24 Ga0070689_100002404 3300005340 Bacteria 12220
25 Ga0068867_100751778 3300005459 Unclassified 865
26 Ga0070684_100121564 3300005535 Bacteria 2349
27 Ga0070684_100559848 3300005535 Bacteria 1061
28 Ga0068857_100092137 3300005577 Bacteria 2713
29 Ga0068857_100129772 3300005577 Bacteria 2273
30 Ga0068856_100000048 3300005614 Bacteria 108732
31 Ga0068863_100139796 3300005841 Bacteria 2314
32 Ga0068863_100466959 3300005841 Bacteria 1240
33 Ga0068860_100002994 3300005843 Bacteria 17452
34 Ga0068860_100849686 3300005843 Unclassified 927
35 Ga0068871_100132514 3300006358 Bacteria 2114
36 Ga0105251_10016602 3300009011 Bacteria 3971
37 Ga0114129_10001241 3300009147 Bacteria 33950
38 Ga0105242_10394025 3300009176 Unclassified 1290
39 Ga0105248_10097921 3300009177 Bacteria 3305
40 Ga0105248_10804434 3300009177 Bacteria 1061
41 Ga0105239_10257956 3300010375 Bacteria 1959
42 Ga0157370_10084578 3300013104 Bacteria 2982
43 Ga0157370_10226913 3300013104 Bacteria 1729
44 Ga0157369_10021118 3300013105 Bacteria 7279
45 Ga0157372_10643189 3300013307 Bacteria 1235
46 Ga0157372_11152471 3300013307 Unclassified 896
47 Ga0157375_10292955 3300013308 Unclassified 1791
48 Ga0182006_1003191 3300015261 Bacteria 8546
49 Ga0182005_1000193 3300015265 Bacteria 41187
50 Ga0209436_100986 3300025208 Bacteria 10973
51 Ga0209646_1000006 3300025246 Bacteria 694084
52 Ga0209026_1000262 3300025250 Bacteria 64597
53 Ga0209130_1008837 3300025284 Bacteria 2931
54 Ga0209758_1002136 3300025297 Bacteria 20845
55 Ga0207426_1000060 3300025302 Bacteria 363139
56 Ga0207426_1000135 3300025302 Bacteria 202216
57 Ga0207713_1024582 3300025735 Bacteria 2805
58 Ga0207705_10579491 3300025909 Unclassified 872
59 Ga0207686_10252017 3300025934 Unclassified 1290
60 Ga0207670_10001793 3300025936 Bacteria 11231
61 Ga0207670_10255808 3300025936 Bacteria 1355
62 Ga0207670_11106553 3300025936 Unclassified 669
63 Ga0207640_11059650 3300025981 Bacteria 716
64 Ga0207702_10006855 3300026078 Bacteria 9769
65 Ga0207641_11667069 3300026088 Unclassified 639
66 Ga0207674_10798622 3300026116 Bacteria 911
67 Ga0268264_10001525 3300028381 Bacteria 21555
68 Ga0307515_10216749 3300028794 Bacteria 1743
69 Ga0265338_10576020 3300028800 Bacteria 786
70 Ga0316177_1056786 3300030731 Bacteria 8239
71 Ga0307408_100000303 3300031548 Bacteria 47267
72 Ga0307408_100005276 3300031548 Bacteria 8656
73 Ga0307408_100006101 3300031548 Bacteria 8012
74 Ga0307408_100042957 3300031548 Bacteria 3214
75 Ga0307405_10095416 3300031731 Bacteria 1980
76 Ga0307405_10504515 3300031731 Bacteria 970
77 Ga0307413_10806498 3300031824 Bacteria 789
78 Ga0307410_10000074 3300031852 Bacteria 34345
79 Ga0307406_10000047 3300031901 Bacteria 69025
80 Ga0307412_10009094 3300031911 Bacteria 5693
81 Ga0307412_10038918 3300031911 Bacteria 3066
82 Ga0307412_10053887 3300031911 Bacteria 2668
83 Ga0307412_10608730 3300031911 Bacteria 926
84 Ga0307414_10000002 3300032004 Bacteria 623006
85 Ga0307414_10006885 3300032004 Bacteria 6363
86 Ga0307414_10015660 3300032004 Bacteria 4583
87 Ga0307414_10308753 3300032004 Bacteria 1341
88 Ga0307414_11082214 3300032004 Bacteria 740
89 Ga0307411_10000001 3300032005 Bacteria 931810
90 Ga0307411_10183972 3300032005 Bacteria 1589
91 Ga0373937_0289191 3300036401 Bacteria 1548
92 Ga0373937_0772743 3300036401 Unclassified 908
93 Ga0373937_1061091 3300036401 Bacteria 759
94 Ga0395905_0146440 3300037471 Bacteria 2222
95 Ga0439436_0029187 3300041404 Bacteria 1607
96 Ga0439457_004944 3300042014 Bacteria 3411
97 Ga0451577_0003808 3300042876 Bacteria 16422
98 Ga0453684_0180498 3300044712 Unclassified 2479
99 Ga0453684_1836085 3300044712 Unclassified 615
100 Ga0451576_0006323 3300045051 Bacteria 14559
101 Ga0451576_0027989 3300045051 Bacteria 6044
102 Ga0451576_0039241 3300045051 Bacteria 5012
103 Ga0495641_0016220 3300046461 Bacteria 3933
104 Ga0495582_0025970 3300046473 Bacteria 3209
105 Ga0495666_0017453 3300046526 Bacteria 3575
106 Ga0495640_0172934 3300046533 Bacteria 1379
107 Ga0495586_0002510 3300046535 Bacteria 9943
108 Ga0495658_0006154 3300046683 Bacteria 5888
109 Ga0495613_0010596 3300046689 Bacteria 6837
110 Ga0495624_0049881 3300046690 Bacteria 2653
111 Ga0501031_0000102 3300049568 Bacteria 45183
112 Ga0501032_0073872 3300049569 Unclassified 2272
113 Ga0501032_0237323 3300049569 Bacteria 1185
114 Ga0501033_0261997 3300049570 Bacteria 1223
115 Ga0501034_0357244 3300049571 Bacteria 1388
116 Ga0501034_1147601 3300049571 Bacteria 657
117 Ga0501036_0212648 3300049572 Bacteria 1624
118 Ga0501038_0400194 3300049574 Bacteria 1062
119 Ga0501039_0004845 3300049575 Bacteria 10188
120 Ga0501043_0002339 3300049579 Bacteria 16062
121 Ga0501043_0506680 3300049579 Unclassified 901
122 Ga0501047_0001591 3300049581 Bacteria 22152
123 Ga0501047_0138856 3300049581 Bacteria 2309
124 Ga0501070_0000571 3300049586 Bacteria 33604
125 Ga0501223_000520 3300049663 Bacteria 9255
126 Ga0501223_001385 3300049663 Bacteria 5592
127 Ga0501238_000041 3300049671 Bacteria 21406
128 Ga0501249_000001 3300049679 Bacteria 268580
129 Ga0501249_000028 3300049679 Bacteria 86906
130 Ga0501083_0024587 3300049744 Bacteria 4172
131 Ga0501266_000035 3300049763 Bacteria 29939
132 Ga0501269_005027 3300049766 Bacteria 1590
133 Ga0501280_000256 3300049776 Bacteria 13372
134 Ga0501035_0000001 3300049822 Bacteria 1037138
135 Ga0501035_0183115 3300049822 Bacteria 1804
136 Ga0501044_0053443 3300049823 Bacteria 4156
137 Ga0501044_0268348 3300049823 Bacteria 1643
138 Ga0501044_0542104 3300049823 Bacteria 1061
139 nmdc:mga05p37_5047_c1 3300050507 Bacteria 15469
140 Ga0500641_0000121 3300053096 Bacteria 29622
141 Ga0500658_0000009 3300053134 Bacteria 270303
142 Ga0500622_0000426 3300053156 Bacteria 39963
143 2513233973 2513020052 Bacteria 5120511
144 2520881134 2519899754 Bacteria 5336938
145 2599478761 2599185184 Bacteria 6430550
146 2644011131 2643221600 Bacteria 5530138
147 2738728637 2738541278 Bacteria 9755573
148 2740002155 2739367857 Bacteria 5433684
149 2740006971 2739367858 Bacteria 5432813
150 2819574221 2818991442 Bacteria 8318214
151 2819678583 2818991460 Bacteria 7595395
152 2857620127 2857618242 Bacteria 5635925
153 2881359982 2881359912 Bacteria 4935907
154 2884792554 2884791551 Bacteria 8511252
155 2904421293 2904419702 Bacteria 5166287
156 2904559844 2904555929 Bacteria 5218588
157 2919688003 2919683626 Bacteria 5534354
158 2928080180 2928078545 Bacteria 6534839
159 2928149647 2928147474 Bacteria 6512076
160 2929154427 2929150217 Bacteria 5462483
161 2929180578 2929177148 Bacteria 7883697
162 2929925042 2929921140 Bacteria 8649150
163 2932083473 2932082852 Bacteria 6563563
164 2945982975 2945977869 Bacteria 7777518
165 2946017630 2946013367 Bacteria 7766675
166 8003157381 8003151029 Bacteria 8187759
167 8055592461 8055592153 Bacteria 5961247
168 Ga0316176_1025862
169 JGI24740J21852_10016211
170 JGI24740J21852_10099935
171 JGI25154J39366_1000044
172 JGI25158J39367_1008629
173 JGI25157J39369_1005701
174 JGI25153J46596_10002544
175 rootH2_10009120
176 rootH2_10069246
177 rootL2_10037395
178 rootL2_10171967
179 rootH1_10012226
180 rootH1_10056421
181 rootH1_10322879
182 JGI25160J50197_1008490
183 JGI25160J50197_1008963
184 Ga0065165_1016784
185 Ga0065715_10090107
186 Ga0070658_10168264
187 Ga0070690_100467444
188 Ga0070670_100929751
189 Ga0070689_100002404
190 Ga0068867_100751778
191 Ga0070684_100121564
192 Ga0070684_100559848
193 Ga0068857_100092137
194 Ga0068857_100129772
195 Ga0068856_100000048
196 Ga0068863_100139796
197 Ga0068863_100466959
198 Ga0068860_100002994
199 Ga0068860_100849686
200 Ga0068871_100132514
201 Ga0105251_10016602
202 Ga0114129_10001241
203 Ga0105242_10394025
204 Ga0105248_10097921
205 Ga0105248_10804434
206 Ga0105239_10257956
207 Ga0157370_10084578
208 Ga0157370_10226913
209 Ga0157369_10021118
210 Ga0157372_10643189
211 Ga0157372_11152471
212 Ga0157375_10292955
213 Ga0182006_1003191
214 Ga0182005_1000193
215 Ga0209436_100986
216 Ga0209646_1000006
217 Ga0209026_1000262
218 Ga0209130_1008837
219 Ga0209758_1002136
220 Ga0207426_1000060
221 Ga0207426_1000135
222 Ga0207713_1024582
223 Ga0207705_10579491
224 Ga0207686_10252017
225 Ga0207670_10001793
226 Ga0207670_10255808
227 Ga0207670_11106553
228 Ga0207640_11059650
229 Ga0207702_10006855
230 Ga0207641_11667069
231 Ga0207674_10798622
232 Ga0268264_10001525
233 Ga0307515_10216749
234 Ga0265338_10576020
235 Ga0316177_1056786
236 Ga0307408_100000303
237 Ga0307408_100005276
238 Ga0307408_100006101
239 Ga0307408_100042957
240 Ga0307405_10095416
241 Ga0307405_10504515
242 Ga0307413_10806498
243 Ga0307410_10000074
244 Ga0307406_10000047
245 Ga0307412_10009094
246 Ga0307412_10038918
247 Ga0307412_10053887
248 Ga0307412_10608730
249 Ga0307414_10000002
250 Ga0307414_10006885
251 Ga0307414_10015660
252 Ga0307414_10308753
253 Ga0307414_11082214
254 Ga0307411_10000001
255 Ga0307411_10183972
256 Ga0373937_0289191
257 Ga0373937_0772743
258 Ga0373937_1061091
259 Ga0395905_0146440
260 Ga0439436_0029187
261 Ga0439457_004944
262 Ga0451577_0003808
263 Ga0453684_0180498
264 Ga0453684_1836085
265 Ga0451576_0006323
266 Ga0451576_0027989
267 Ga0451576_0039241
268 Ga0495641_0016220
269 Ga0495582_0025970
270 Ga0495666_0017453
271 Ga0495640_0172934
272 Ga0495586_0002510
273 Ga0495658_0006154
274 Ga0495613_0010596
275 Ga0495624_0049881
276 Ga0501031_0000102
277 Ga0501032_0073872
278 Ga0501032_0237323
279 Ga0501033_0261997
280 Ga0501034_0357244
281 Ga0501034_1147601
282 Ga0501036_0212648
283 Ga0501038_0400194
284 Ga0501039_0004845
285 Ga0501043_0002339
286 Ga0501043_0506680
287 Ga0501047_0001591
288 Ga0501047_0138856
289 Ga0501070_0000571
290 Ga0501223_000520
291 Ga0501223_001385
292 Ga0501238_000041
293 Ga0501249_000001
294 Ga0501249_000028
295 Ga0501083_0024587
296 Ga0501266_000035
297 Ga0501269_005027
298 Ga0501280_000256
299 Ga0501035_0000001
300 Ga0501035_0183115
301 Ga0501044_0053443
302 Ga0501044_0268348
303 Ga0501044_0542104
304 nmdc:mga05p37_5047_c1
305 Ga0500641_0000121
306 Ga0500658_0000009
307 Ga0500622_0000426
308 2513233973
309 2520881134
310 2599478761
311 2644011131
312 2738728637
313 2740002155
314 2740006971
315 2819574221
316 2819678583
317 2857620127
318 2881359982
319 2884792554
320 2904421293
321 2904559844
322 2919688003
323 2928080180
324 2928149647
325 2929154427
326 2929180578
327 2929925042
328 2932083473
329 2945982975
330 2946017630
331 8003157381
332 8055592461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

67

157

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.9021 62 161
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.8808 62 162
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8703 62 164
7bui-assembly1.cif.gz_D complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.861 64 161
1vm9-assembly1.cif.gz_A the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1 0.861 62 162
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8787 61 165 2.20.25.680
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8651 61 165 2.20.25.680
1vm9A00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.861 62 162 2.102.10.10
4nbbE00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.859 61 164 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8587 64 163 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A3C1VH47-F1-model_v4 (2Fe-2S)-binding protein 0.9457 38 165 GO:0016020
GO:0046872
GO:0051537
AF-W4PZE4-F1-model_v4 Rieske 0.9416 68 163 GO:0046872
GO:0051537
AF-A0A258JM64-F1-model_v4 (2Fe-2S)-binding protein 0.9212 78 172 GO:0016020
GO:0046872
GO:0051537
AF-A0A4R1BR09-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.9157 64 160 GO:0016020
GO:0046872
GO:0051537
AF-A0A838J7D2-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.915 64 161 GO:0016020
GO:0046872
GO:0051537

Map