F246544

General Info

Members Datasets Scaffolds Average Seq Length
165 104 140 116

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10003653|Ga0316593_100036534
Length 126
Sequence MPASLSDPGAAMTITIYHNPRCSKSRKALDLLQDKGIEPQIVKYLETPPDAATLEHLLDMLGLEPREIMRKKEKEYKENDLANPDLSREDLIAAMVAHPKLIERPIVVKDDKAALGRPPESVLDIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
7 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
8 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
9 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
10 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
11 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
12 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
13 2847085930 Erwinia persicina B64 Isolate Bulb
14 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
15 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
16 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
17 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
18 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
19 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
20 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
21 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
22 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
23 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
24 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
54 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
62 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
72 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
75 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
104 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 3.03
Isolates 15.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.61
Endosphere 3.03
Nodule 4.24
Rhizoplane 1.82
Rhizosphere 70.3
Stem 0
Stem Tuber 4.24
Unclassified 15.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1562962 2162886007 Bacteria 11676
2 Ga0058692_1001814 3300003856 Bacteria 7533
3 Ga0065704_10000896 3300005289 Bacteria 11141
4 Ga0070660_101371547 3300005339 Bacteria 600
5 Ga0070665_100587987 3300005548 Bacteria 1126
6 Ga0075364_10024451 3300006051 Bacteria 3836
7 Ga0075366_10017802 3300006195 Bacteria 4097
8 Ga0075428_101134646 3300006844 Unclassified 825
9 Ga0079104_1000075 3300006946 Bacteria 148544
10 Ga0079104_1000929 3300006946 Bacteria 23334
11 Ga0079104_1004793 3300006946 Bacteria 5637
12 Ga0105244_10000090 3300009036 Bacteria 97171
13 Ga0105244_10001551 3300009036 Bacteria 18279
14 Ga0105244_10007882 3300009036 Bacteria 6716
15 Ga0105244_10020016 3300009036 Bacteria 3720
16 Ga0105244_10027336 3300009036 Bacteria 3076
17 Ga0105250_10011513 3300009092 Bacteria 3667
18 Ga0105250_10158957 3300009092 Bacteria 943
19 Ga0105249_10069688 3300009553 Bacteria 3246
20 Ga0157373_10250609 3300013100 Bacteria 1252
21 Ga0157371_10001330 3300013102 Bacteria 25968
22 Ga0157372_10137316 3300013307 Bacteria 2816
23 Ga0163161_10189828 3300017792 Bacteria 1579
24 Ga0163161_10307342 3300017792 Bacteria 1250
25 Ga0207696_1019863 3300025711 Bacteria 2176
26 Ga0207696_1033187 3300025711 Bacteria 1548
27 Ga0207696_1074443 3300025711 Bacteria 942
28 Ga0207655_1000002 3300025728 Bacteria 1148694
29 Ga0207655_1000004 3300025728 Bacteria 1021221
30 Ga0207655_1000062 3300025728 Bacteria 258054
31 Ga0207655_1038142 3300025728 Bacteria 2105
32 Ga0207655_1039870 3300025728 Bacteria 2035
33 Ga0207655_1067258 3300025728 Bacteria 1350
34 Ga0207655_1120321 3300025728 Bacteria 871
35 Ga0207655_1192386 3300025728 Bacteria 615
36 Ga0207713_1002290 3300025735 Bacteria 14093
37 Ga0207713_1017002 3300025735 Bacteria 3669
38 Ga0207713_1102727 3300025735 Bacteria 984
39 Ga0207713_1257312 3300025735 Bacteria 512
40 Ga0207712_10194998 3300025961 Bacteria 1601
41 Ga0209281_1000004 3300027111 Bacteria 1253949
42 Ga0209281_1000079 3300027111 Bacteria 261444
43 Ga0209281_1000171 3300027111 Bacteria 153284
44 Ga0209281_1000735 3300027111 Bacteria 32059
45 Ga0209371_1000001 3300027312 Bacteria 2771503
46 Ga0209371_1002584 3300027312 Bacteria 9958
47 Ga0209371_1004865 3300027312 Bacteria 5620
48 Ga0268266_10528571 3300028379 Bacteria 1128
49 Ga0268256_1000001 3300030500 Bacteria 2771065
50 Ga0268256_1002537 3300030500 Bacteria 9189
51 Ga0268256_1007678 3300030500 Bacteria 3806
52 Ga0316575_10044093 3300031665 Bacteria 1769
53 Ga0316575_10222055 3300031665 Unclassified 789
54 Ga0316579_10029411 3300031691 Bacteria 2507
55 Ga0316579_10043279 3300031691 Bacteria 2094
56 Ga0316579_10496674 3300031691 Bacteria 590
57 Ga0316576_10006592 3300031727 Bacteria 7247
58 Ga0316576_10092490 3300031727 Bacteria 2254
59 Ga0316576_10185510 3300031727 Bacteria 1569
60 Ga0316576_10353743 3300031727 Bacteria 1093
61 Ga0316576_10740200 3300031727 Bacteria 710
62 Ga0316578_10000886 3300031728 Bacteria 11290
63 Ga0316578_10005083 3300031728 Bacteria 6329
64 Ga0316578_10080882 3300031728 Bacteria 1933
65 Ga0316578_10103820 3300031728 Bacteria 1705
66 Ga0316577_10015468 3300031733 Bacteria 4198
67 Ga0316585_10013504 3300032137 Bacteria 2432
68 Ga0316593_10003653 3300032168 Bacteria 3851
69 Ga0316593_10016367 3300032168 Bacteria 2247
70 Ga0316592_1074751 3300033524 Bacteria 768
71 Ga0316587_1079672 3300033529 Bacteria 618
72 Ga0316596_1006421 3300033541 Bacteria 2734
73 Ga0316574_0034763 3300035398 Bacteria 3075
74 Ga0316574_0073498 3300035398 Bacteria 2162
75 Ga0316574_0075720 3300035398 Bacteria 2132
76 Ga0316574_0103411 3300035398 Bacteria 1824
77 Ga0316574_0105306 3300035398 Bacteria 1807
78 Ga0316574_0171006 3300035398 Bacteria 1399
79 Ga0316574_0465318 3300035398 Bacteria 791
80 Ga0316582_0203970 3300036647 Bacteria 1349
81 Ga0316584_0009995 3300036712 Bacteria 6611
82 Ga0316584_0108504 3300036712 Bacteria 2077
83 Ga0316584_0116357 3300036712 Bacteria 1999
84 Ga0316584_0192624 3300036712 Unclassified 1507
85 Ga0316584_0479466 3300036712 Bacteria 876
86 Ga0316581_0013560 3300037588 Bacteria 2312
87 Ga0451804_1142028 3300041463 Bacteria 527
88 Ga0451843_1053889 3300041509 Bacteria 649
89 Ga0451853_3769164 3300041512 Unclassified 629
90 Ga0495591_000066 3300046458 Bacteria 121317
91 Ga0495607_0005186 3300046501 Bacteria 9395
92 Ga0495616_0306392 3300046513 Bacteria 670
93 Ga0495654_0009530 3300046530 Bacteria 5323
94 Ga0495654_0021239 3300046530 Bacteria 3379
95 Ga0495654_0407470 3300046530 Bacteria 539
96 Ga0495625_0008066 3300046660 Bacteria 9029
97 Ga0495672_0000009 3300047320 Bacteria 557755
98 Ga0495679_000195 3300047446 Bacteria 53965
99 Ga0495673_0000071 3300047469 Bacteria 217117
100 Ga0496116_0000404 3300048919 Bacteria 62080
101 Ga0496116_0012348 3300048919 Bacteria 6983
102 Ga0496117_0006717 3300048920 Bacteria 11492
103 Ga0496118_0078489 3300048921 Bacteria 2335
104 Ga0496118_0145614 3300048921 Bacteria 1492
105 Ga0496119_0006240 3300048922 Bacteria 11135
106 Ga0496119_0177297 3300048922 Bacteria 1120
107 Ga0496120_0000920 3300048923 Bacteria 40931
108 Ga0496120_0343283 3300048923 Bacteria 672
109 Ga0496121_0019307 3300048924 Bacteria 6821
110 Ga0496121_0067592 3300048924 Bacteria 2896
111 Ga0496122_0000003 3300048925 Bacteria 645810
112 Ga0496123_0000012 3300048926 Bacteria 458760
113 Ga0496124_0040666 3300048927 Bacteria 4020
114 Ga0496124_0051548 3300048927 Bacteria 3501
115 Ga0496124_0448429 3300048927 Bacteria 880
116 Ga0496125_0060647 3300048928 Bacteria 3039
117 Ga0496126_0039744 3300048929 Bacteria 4363
118 Ga0496126_0949556 3300048929 Bacteria 648
119 Ga0501031_0213009 3300049568 Unclassified 1259
120 Ga0501034_0224405 3300049571 Bacteria 1830
121 Ga0501036_0533176 3300049572 Unclassified 976
122 Ga0501039_0055712 3300049575 Bacteria 3063
123 Ga0501041_0141941 3300049577 Bacteria 1498
124 Ga0501042_0480166 3300049578 Bacteria 902
125 Ga0501042_0572955 3300049578 Bacteria 821
126 Ga0501071_0399472 3300049587 Bacteria 1049
127 Ga0501071_0445648 3300049587 Bacteria 991
128 Ga0501074_0029844 3300049590 Bacteria 3952
129 Ga0501075_0047417 3300049591 Bacteria 3229
130 Ga0501076_1506658 3300049592 Unclassified 552
131 Ga0501077_0062726 3300049593 Bacteria 2358
132 Ga0501079_0591291 3300049741 Bacteria 873
133 Ga0501035_1110973 3300049822 Bacteria 617
134 Ga0501045_0122583 3300049824 Bacteria 1930
135 nmdc:mga00v17_15720_c1 3300050491 Bacteria 4253
136 nmdc:mga0k408_12274_c2 3300050493 Bacteria 3854
137 nmdc:mga08y16_887200_c1 3300050511 Unclassified 879
138 Ga0500645_038605 3300053730 Bacteria 1416
139 Ga0501082_0531335 3300060353 Unclassified 1028
140 Ga0530510_1098726 3300061734 Bacteria 609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_101134646 Ga0075428_1011346461 97
2 3300049568 Ga0501031_0213009 Ga0501031_0213009_814_1116 97
3 3300049572 Ga0501036_0533176 Ga0501036_0533176_125_427 97
4 3300049575 Ga0501039_0055712 Ga0501039_0055712_892_1194 97
5 3300049577 Ga0501041_0141941 Ga0501041_0141941_862_1164 97
6 3300049578 Ga0501042_0480166 Ga0501042_0480166_101_403 97
7 3300049587 Ga0501071_0399472 Ga0501071_0399472_363_665 97
8 3300049590 Ga0501074_0029844 Ga0501074_0029844_193_495 97
9 3300049591 Ga0501075_0047417 Ga0501075_0047417_2642_2944 97
10 3300049593 Ga0501077_0062726 Ga0501077_0062726_517_819 97
11 3300049822 Ga0501035_1110973 Ga0501035_1110973_304_606 97
12 3300049824 Ga0501045_0122583 Ga0501045_0122583_737_1039 97
13 3300060353 Ga0501082_0531335 Ga0501082_0531335_46_348 97
14 3300009036 Ga0105244_10027336 Ga0105244_100273363 109
15 3300025728 Ga0207655_1038142 Ga0207655_10381423 109
16 iso_pu_bacteria 2511231025 2511381692 111
17 iso_pu_bacteria 2511231035 2511432707 111
18 iso_pu_bacteria 2738541273 2738700266 111
19 iso_pu_bacteria 2738543014 2739254015 111
20 iso_pu_bacteria 2510065053 2510283553 113
21 iso_pu_bacteria 2510065058 2510311711 113
22 iso_pu_bacteria 2773857672 2774128675 113
23 iso_pu_bacteria 2847085930 2847086277 113
24 iso_pu_bacteria 2908669403 2908672665 113
25 3300041463 Ga0451804_1142028 Ga0451804_1142028_170_514 114
26 3300053730 Ga0500645_038605 Ga0500645_038605_732_1076 114
27 iso_pu_bacteria 2671180115 2671588680 114
28 iso_pu_bacteria 2706794495 2707099905 114
29 iso_pu_bacteria 2791355010 2792311844 114
30 iso_pu_bacteria 2854601825 2854602716 114
31 iso_pu_bacteria 2923634449 2923636044 114
32 iso_pu_bacteria 8055693939 8055697094 114
33 3300009553 Ga0105249_10069688 Ga0105249_100696882 115
34 3300025728 Ga0207655_1120321 Ga0207655_11203212 115
35 3300025735 Ga0207713_1257312 Ga0207713_12573121 115
36 3300025961 Ga0207712_10194998 Ga0207712_101949982 115
37 3300031665 Ga0316575_10222055 Ga0316575_102220552 115
38 3300031691 Ga0316579_10029411 Ga0316579_100294112 115
39 3300031691 Ga0316579_10496674 Ga0316579_104966741 115
40 3300031727 Ga0316576_10006592 Ga0316576_100065927 115
41 3300031727 Ga0316576_10092490 Ga0316576_100924904 115
42 3300031727 Ga0316576_10185510 Ga0316576_101855102 115
43 3300031727 Ga0316576_10740200 Ga0316576_107402002 115
44 3300031728 Ga0316578_10000886 Ga0316578_1000088610 115
45 3300031728 Ga0316578_10080882 Ga0316578_100808822 115
46 3300031728 Ga0316578_10103820 Ga0316578_101038202 115
47 3300032168 Ga0316593_10016367 Ga0316593_100163673 115
48 3300033524 Ga0316592_1074751 Ga0316592_10747512 115
49 3300033529 Ga0316587_1079672 Ga0316587_10796721 115
50 3300033541 Ga0316596_1006421 Ga0316596_10064213 115
51 3300035398 Ga0316574_0034763 Ga0316574_0034763_1982_2338 115
52 3300035398 Ga0316574_0073498 Ga0316574_0073498_206_562 115
53 3300035398 Ga0316574_0075720 Ga0316574_0075720_1543_1902 115
54 3300035398 Ga0316574_0103411 Ga0316574_0103411_806_1153 115
55 3300035398 Ga0316574_0105306 Ga0316574_0105306_350_706 115
56 3300035398 Ga0316574_0171006 Ga0316574_0171006_958_1305 115
57 3300036712 Ga0316584_0009995 Ga0316584_0009995_4959_5306 115
58 3300036712 Ga0316584_0108504 Ga0316584_0108504_14_370 115
59 3300036712 Ga0316584_0192624 Ga0316584_0192624_445_801 115
60 3300041509 Ga0451843_1053889 Ga0451843_1053889_206_562 115
61 3300048927 Ga0496124_0051548 Ga0496124_0051548_1058_1405 115
62 3300048929 Ga0496126_0039744 Ga0496126_0039744_3160_3507 115
63 3300049571 Ga0501034_0224405 Ga0501034_0224405_1140_1499 115
64 3300049578 Ga0501042_0572955 Ga0501042_0572955_35_388 115
65 3300049587 Ga0501071_0445648 Ga0501071_0445648_586_939 115
66 3300049592 Ga0501076_1506658 Ga0501076_1506658_55_411 115
67 3300049741 Ga0501079_0591291 Ga0501079_0591291_119_475 115
68 3300050511 nmdc:mga08y16_887200_c1 nmdc:mga08y16_887200_c1_12_368 115
69 3300061734 Ga0530510_1098726 Ga0530510_1098726_41_397 115
70 iso_pu_bacteria 2884086401 2884087696 115
71 iso_pu_bacteria 2939568625 2939570161 115
72 iso_pu_bacteria 2939642701 2939642796 115
73 3300031665 Ga0316575_10044093 Ga0316575_100440933 116
74 3300031691 Ga0316579_10043279 Ga0316579_100432793 116
75 3300031727 Ga0316576_10353743 Ga0316576_103537432 116
76 3300031728 Ga0316578_10005083 Ga0316578_100050836 116
77 3300031733 Ga0316577_10015468 Ga0316577_100154683 116
78 3300032137 Ga0316585_10013504 Ga0316585_100135043 116
79 3300036647 Ga0316582_0203970 Ga0316582_0203970_473_823 116
80 3300036712 Ga0316584_0116357 Ga0316584_0116357_1602_1952 116
81 3300037588 Ga0316581_0013560 Ga0316581_0013560_1415_1765 116
82 3300041512 Ga0451853_3769164 Ga0451853_3769164_262_618 116
83 3300013100 Ga0157373_10250609 Ga0157373_102506092 117
84 3300013102 Ga0157371_10001330 Ga0157371_100013303 117
85 3300017792 Ga0163161_10189828 Ga0163161_101898283 117
86 3300025728 Ga0207655_1039870 Ga0207655_10398702 117
87 3300025728 Ga0207655_1192386 Ga0207655_11923862 117
88 3300025735 Ga0207713_1102727 Ga0207713_11027272 117
89 3300032168 Ga0316593_10003653 Ga0316593_100036534 117
90 3300035398 Ga0316574_0465318 Ga0316574_0465318_309_725 117
91 3300036712 Ga0316584_0479466 Ga0316584_0479466_19_447 117
92 3300046501 Ga0495607_0005186 Ga0495607_0005186_4994_5368 117
93 3300047320 Ga0495672_0000009 Ga0495672_0000009_296_649 117
94 3300048924 Ga0496121_0067592 Ga0496121_0067592_1990_2355 117
95 3300048927 Ga0496124_0040666 Ga0496124_0040666_2638_2991 117
96 iso_pu_bacteria 2858466076 2858469999 117
97 3300003856 Ga0058692_1001814 Ga0058692_10018146 118
98 3300005339 Ga0070660_101371547 Ga0070660_1013715472 118
99 3300006195 Ga0075366_10017802 Ga0075366_100178023 118
100 3300006946 Ga0079104_1000075 Ga0079104_1000075102 118
101 3300006946 Ga0079104_1004793 Ga0079104_10047934 118
102 3300009036 Ga0105244_10007882 Ga0105244_100078824 118
103 3300009036 Ga0105244_10020016 Ga0105244_100200164 118
104 3300009092 Ga0105250_10011513 Ga0105250_100115132 118
105 3300013307 Ga0157372_10137316 Ga0157372_101373164 118
106 3300025711 Ga0207696_1033187 Ga0207696_10331872 118
107 3300025728 Ga0207655_1000002 Ga0207655_1000002102 118
108 3300025728 Ga0207655_1067258 Ga0207655_10672581 118
109 3300025735 Ga0207713_1017002 Ga0207713_10170022 118
110 3300027111 Ga0209281_1000079 Ga0209281_100007929 118
111 3300027111 Ga0209281_1000171 Ga0209281_1000171102 118
112 3300027111 Ga0209281_1000735 Ga0209281_10007358 118
113 3300027312 Ga0209371_1000001 Ga0209371_10000012512 118
114 3300027312 Ga0209371_1002584 Ga0209371_100258410 118
115 3300027312 Ga0209371_1004865 Ga0209371_10048655 118
116 3300030500 Ga0268256_1000001 Ga0268256_1000001128 118
117 3300030500 Ga0268256_1002537 Ga0268256_10025371 118
118 3300030500 Ga0268256_1007678 Ga0268256_10076782 118
119 3300046513 Ga0495616_0306392 Ga0495616_0306392_73_429 118
120 3300046530 Ga0495654_0009530 Ga0495654_0009530_1940_2296 118
121 3300046530 Ga0495654_0021239 Ga0495654_0021239_2458_2814 118
122 3300046660 Ga0495625_0008066 Ga0495625_0008066_6140_6496 118
123 3300047446 Ga0495679_000195 Ga0495679_000195_50951_51307 118
124 3300048919 Ga0496116_0000404 Ga0496116_0000404_28205_28573 118
125 3300048922 Ga0496119_0006240 Ga0496119_0006240_5919_6287 118
126 3300048923 Ga0496120_0000920 Ga0496120_0000920_32468_32836 118
127 3300048924 Ga0496121_0019307 Ga0496121_0019307_1746_2102 118
128 3300050493 nmdc:mga0k408_12274_c2 nmdc:mga0k408_12274_c2_1494_1850 118
129 iso_pu_bacteria 2855195626 2855197442 118
130 iso_pu_bacteria 2871272651 2871277280 118
131 iso_pu_bacteria 2900051742 2900054204 118
132 iso_pu_bacteria 2900051742 2900055870 118
133 2162886007 SwRhRL2b_contig_1562962 SwRhRL2b_0661.00001830 119
134 3300005289 Ga0065704_10000896 Ga0065704_100008963 119
135 3300005548 Ga0070665_100587987 Ga0070665_1005879872 119
136 3300006051 Ga0075364_10024451 Ga0075364_100244512 119
137 3300006946 Ga0079104_1000929 Ga0079104_100092917 119
138 3300009036 Ga0105244_10000090 Ga0105244_1000009043 119
139 3300009036 Ga0105244_10001551 Ga0105244_100015518 119
140 3300009092 Ga0105250_10158957 Ga0105250_101589571 119
141 3300017792 Ga0163161_10307342 Ga0163161_103073422 119
142 3300025711 Ga0207696_1019863 Ga0207696_10198633 119
143 3300025711 Ga0207696_1074443 Ga0207696_10744431 119
144 3300025728 Ga0207655_1000004 Ga0207655_1000004111 119
145 3300025728 Ga0207655_1000062 Ga0207655_1000062151 119
146 3300025735 Ga0207713_1002290 Ga0207713_100229011 119
147 3300027111 Ga0209281_1000004 Ga0209281_100000492 119
148 3300028379 Ga0268266_10528571 Ga0268266_105285712 119
149 3300046458 Ga0495591_000066 Ga0495591_000066_39250_39609 119
150 3300046530 Ga0495654_0407470 Ga0495654_0407470_157_516 119
151 3300047469 Ga0495673_0000071 Ga0495673_0000071_55491_55850 119
152 3300048919 Ga0496116_0012348 Ga0496116_0012348_5916_6275 119
153 3300048920 Ga0496117_0006717 Ga0496117_0006717_10048_10407 119
154 3300048921 Ga0496118_0078489 Ga0496118_0078489_891_1250 119
155 3300048921 Ga0496118_0145614 Ga0496118_0145614_48_407 119
156 3300048922 Ga0496119_0177297 Ga0496119_0177297_611_970 119
157 3300048923 Ga0496120_0343283 Ga0496120_0343283_67_426 119
158 3300048925 Ga0496122_0000003 Ga0496122_0000003_616646_617005 119
159 3300048926 Ga0496123_0000012 Ga0496123_0000012_371829_372188 119
160 3300048927 Ga0496124_0448429 Ga0496124_0448429_289_648 119
161 3300048928 Ga0496125_0060647 Ga0496125_0060647_2226_2585 119
162 3300048929 Ga0496126_0949556 Ga0496126_0949556_278_637 119
163 3300050491 nmdc:mga00v17_15720_c1 nmdc:mga00v17_15720_c1_1839_2198 119
164 iso_pu_bacteria 2537561728 2538428389 119
165 iso_pu_bacteria 2871282230 2871286775 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

17

125

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9907 4 117
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9822 4 117
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9748 1 117
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9587 1 117
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9332 4 117
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9907 4 117 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9822 4 117 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.932 4 119 3.40.30.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9033 6 33 3.40.30.10
af_Q9VSL3_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8895 4 33 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0A2W532-F1-model_v4 TPR repeat-containing protein yfgC 1.004 15 117 GO:0004222
GO:0008794
GO:0016020
GO:0042597
GO:0046872
GO:0051603
GO:0061077
AF-A0A0H3I8S3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 4 117 GO:0008794
AF-A0A1W9F1F8-F1-model_v4 deleted 1.002 4 117
AF-A0A7U9G0G7-F1-model_v4 deleted 0.999 1 119
AF-G7YYC1-F1-model_v4 Metalloendopeptidase OMA1, mitochondrial (Overlapping with the m-AAA protease 1 homolog) 0.9984 14 112 GO:0004222
GO:0008794
GO:0016020
GO:0046872
GO:0051603
GO:0061077

Feature Viewer

pLDDT pTM Quality
95.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map