F246552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 58 | 330 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300033528|Ga0316588_1000686|Ga0316588_10006862 |
| Length | 259 |
| Sequence | VENGSKWQEGTYLSSLTVVYASVFYLAFLTLLGGLAFKITKYATVPAPLKIPTTPAPVTQGGVVLRIIREVVFFESLFKGAKWIWAFGWLFHISLLLVLLRHTRYFLPWVPEPIVLIQPFGMYAGFTMIVGLAGLWARRFLVDRVRYISAPSDHLILALIILIGLSGLGMKFLVHTDVASVKAFFQGLMTFHWHELPDDPLLVVHLSLVAVLMIIFPYSKLLHAPGIFFSPTRNQIDNPREQRHLSEWARRLEQHEGQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 4 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 5 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 6 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 7 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 8 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 9 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 10 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 11 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 12 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 13 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 14 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 15 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 16 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 17 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 18 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 24 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 25 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 26 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 27 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 28 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 29 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 30 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 31 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 32 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 33 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 34 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 35 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 36 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 38 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 39 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 40 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 41 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 42 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 43 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 44 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 45 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 46 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 47 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 48 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 49 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 50 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 51 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 52 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 53 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 54 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 55 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 56 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 57 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 58 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.33 |
| Metatranscriptomes | 26.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316588_1000686 | 3300033528 | Bacteria | 4947 |
| 2 | Ga0065707_10085058 | 3300005295 | Bacteria | 6499 |
| 3 | Ga0265336_10003160 | 3300028666 | Bacteria | 6552 |
| 4 | Ga0265324_10000005 | 3300029957 | Bacteria | 347038 |
| 5 | Ga0265325_10008145 | 3300031241 | Bacteria | 6209 |
| 6 | Ga0265331_10015536 | 3300031250 | Bacteria | 4017 |
| 7 | Ga0265327_10101519 | 3300031251 | Bacteria | 1387 |
| 8 | Ga0265316_10164624 | 3300031344 | Bacteria | 1657 |
| 9 | Ga0265313_10000346 | 3300031595 | Bacteria | 50381 |
| 10 | Ga0316575_10002255 | 3300031665 | Bacteria | 6441 |
| 11 | Ga0316575_10025859 | 3300031665 | Bacteria | 2278 |
| 12 | Ga0316575_10036997 | 3300031665 | Bacteria | 1921 |
| 13 | Ga0316575_10041842 | 3300031665 | Bacteria | 1813 |
| 14 | Ga0265314_10065063 | 3300031711 | Bacteria | 2465 |
| 15 | Ga0316576_10014828 | 3300031727 | Bacteria | 5212 |
| 16 | Ga0316576_10017441 | 3300031727 | Bacteria | 4877 |
| 17 | Ga0316576_10037283 | 3300031727 | Bacteria | 3480 |
| 18 | Ga0316576_10084878 | 3300031727 | Bacteria | 2353 |
| 19 | Ga0316576_10194252 | 3300031727 | Bacteria | 1530 |
| 20 | Ga0316576_10241230 | 3300031727 | Bacteria | 1358 |
| 21 | Ga0316578_10048293 | 3300031728 | Bacteria | 2485 |
| 22 | Ga0316578_10071758 | 3300031728 | Bacteria | 2051 |
| 23 | Ga0316578_10104437 | 3300031728 | Bacteria | 1699 |
| 24 | Ga0316577_10020344 | 3300031733 | Bacteria | 3678 |
| 25 | Ga0316577_10034507 | 3300031733 | Bacteria | 2827 |
| 26 | Ga0316577_10137288 | 3300031733 | Bacteria | 1377 |
| 27 | Ga0316583_10004318 | 3300032133 | Bacteria | 5069 |
| 28 | Ga0316583_10009872 | 3300032133 | Bacteria | 3439 |
| 29 | Ga0316585_10052906 | 3300032137 | Bacteria | 1305 |
| 30 | Ga0316580_10003963 | 3300032139 | Bacteria | 4257 |
| 31 | Ga0316580_10004859 | 3300032139 | Bacteria | 3907 |
| 32 | Ga0316593_10000057 | 3300032168 | Bacteria | 12699 |
| 33 | Ga0316593_10000066 | 3300032168 | Bacteria | 12417 |
| 34 | Ga0316593_10000078 | 3300032168 | Bacteria | 11839 |
| 35 | Ga0316593_10000317 | 3300032168 | Bacteria | 8288 |
| 36 | Ga0316593_10000522 | 3300032168 | Bacteria | 7129 |
| 37 | Ga0316593_10001991 | 3300032168 | Bacteria | 4707 |
| 38 | Ga0316593_10004772 | 3300032168 | Bacteria | 3515 |
| 39 | Ga0316593_10005339 | 3300032168 | Bacteria | 3379 |
| 40 | Ga0316593_10005488 | 3300032168 | Bacteria | 3350 |
| 41 | Ga0316593_10006991 | 3300032168 | Bacteria | 3076 |
| 42 | Ga0316593_10016793 | 3300032168 | Bacteria | 2224 |
| 43 | Ga0316593_10019449 | 3300032168 | Bacteria | 2099 |
| 44 | Ga0316593_10026772 | 3300032168 | Bacteria | 1846 |
| 45 | Ga0316593_10085250 | 3300032168 | Bacteria | 1107 |
| 46 | Ga0316593_10143581 | 3300032168 | Bacteria | 865 |
| 47 | Ga0316592_1002883 | 3300033524 | Bacteria | 3028 |
| 48 | Ga0316592_1009946 | 3300033524 | Bacteria | 1910 |
| 49 | Ga0316592_1011528 | 3300033524 | Bacteria | 1798 |
| 50 | Ga0316592_1021088 | 3300033524 | Bacteria | 1386 |
| 51 | Ga0316586_1000085 | 3300033527 | Bacteria | 6668 |
| 52 | Ga0316586_1000687 | 3300033527 | Bacteria | 3416 |
| 53 | Ga0316586_1001040 | 3300033527 | Bacteria | 2998 |
| 54 | Ga0316586_1002713 | 3300033527 | Bacteria | 2242 |
| 55 | Ga0316588_1003311 | 3300033528 | Bacteria | 2921 |
| 56 | Ga0316588_1004645 | 3300033528 | Bacteria | 2616 |
| 57 | Ga0316588_1005188 | 3300033528 | Bacteria | 2520 |
| 58 | Ga0316588_1014430 | 3300033528 | Bacteria | 1729 |
| 59 | Ga0316587_1000257 | 3300033529 | Bacteria | 4795 |
| 60 | Ga0316587_1000617 | 3300033529 | Bacteria | 3762 |
| 61 | Ga0316587_1007574 | 3300033529 | Bacteria | 1688 |
| 62 | Ga0316596_1000113 | 3300033541 | Bacteria | 10478 |
| 63 | Ga0316596_1000299 | 3300033541 | Bacteria | 7862 |
| 64 | Ga0316596_1003020 | 3300033541 | Bacteria | 3653 |
| 65 | Ga0316596_1005042 | 3300033541 | Bacteria | 2996 |
| 66 | Ga0316596_1005524 | 3300033541 | Bacteria | 2893 |
| 67 | Ga0316596_1008577 | 3300033541 | Bacteria | 2441 |
| 68 | Ga0316596_1009162 | 3300033541 | Bacteria | 2372 |
| 69 | Ga0316596_1009679 | 3300033541 | Bacteria | 2314 |
| 70 | Ga0316596_1011833 | 3300033541 | Bacteria | 2139 |
| 71 | Ga0316596_1011944 | 3300033541 | Bacteria | 2130 |
| 72 | Ga0316596_1013011 | 3300033541 | Bacteria | 2052 |
| 73 | Ga0316596_1016325 | 3300033541 | Unclassified | 1859 |
| 74 | Ga0316596_1073992 | 3300033541 | Bacteria | 913 |
| 75 | Ga0373951_0019965 | 3300035091 | Bacteria | 1532 |
| 76 | Ga0316574_0008415 | 3300035398 | Bacteria | 5726 |
| 77 | Ga0316574_0010207 | 3300035398 | Bacteria | 5295 |
| 78 | Ga0316574_0015247 | 3300035398 | Bacteria | 4458 |
| 79 | Ga0316574_0048692 | 3300035398 | Bacteria | 2633 |
| 80 | Ga0316574_0050674 | 3300035398 | Bacteria | 2585 |
| 81 | Ga0316574_0221595 | 3300035398 | Bacteria | 1212 |
| 82 | Ga0373924_0000584 | 3300035410 | Bacteria | 11229 |
| 83 | Ga0316582_0047730 | 3300036647 | Bacteria | 2705 |
| 84 | Ga0316582_0080440 | 3300036647 | Bacteria | 2127 |
| 85 | Ga0316582_0090050 | 3300036647 | Bacteria | 2018 |
| 86 | Ga0316582_0094246 | 3300036647 | Bacteria | 1975 |
| 87 | Ga0316582_0108692 | 3300036647 | Bacteria | 1844 |
| 88 | Ga0316582_0161432 | 3300036647 | Bacteria | 1518 |
| 89 | Ga0316582_0179986 | 3300036647 | Bacteria | 1438 |
| 90 | Ga0316582_0286906 | 3300036647 | Bacteria | 1130 |
| 91 | Ga0316584_0020862 | 3300036712 | Bacteria | 4757 |
| 92 | Ga0316584_0038370 | 3300036712 | Bacteria | 3563 |
| 93 | Ga0316584_0041454 | 3300036712 | Bacteria | 3431 |
| 94 | Ga0316584_0055175 | 3300036712 | Bacteria | 2975 |
| 95 | Ga0316584_0071835 | 3300036712 | Bacteria | 2593 |
| 96 | Ga0316584_0110512 | 3300036712 | Bacteria | 2057 |
| 97 | Ga0395899_0138395 | 3300037312 | Bacteria | 1734 |
| 98 | Ga0395900_0015964 | 3300037418 | Bacteria | 7651 |
| 99 | Ga0395905_0043287 | 3300037471 | Bacteria | 4224 |
| 100 | Ga0439435_0000113 | 3300042436 | Bacteria | 10379 |
| 101 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 102 | Ga0451577_0000613 | 3300042876 | Bacteria | 57448 |
| 103 | Ga0451577_0002704 | 3300042876 | Bacteria | 20631 |
| 104 | Ga0451577_0038670 | 3300042876 | Bacteria | 4290 |
| 105 | Ga0451577_0178323 | 3300042876 | Bacteria | 1915 |
| 106 | Ga0451577_0463293 | 3300042876 | Bacteria | 1151 |
| 107 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 108 | Ga0453683_0011037 | 3300044673 | Bacteria | 5971 |
| 109 | Ga0453683_0029423 | 3300044673 | Bacteria | 3473 |
| 110 | Ga0453683_0143260 | 3300044673 | Bacteria | 1509 |
| 111 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 112 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 113 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 114 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 115 | Ga0453684_0000077 | 3300044712 | Bacteria | 435536 |
| 116 | Ga0453684_0003047 | 3300044712 | Bacteria | 38939 |
| 117 | Ga0453684_0011034 | 3300044712 | Bacteria | 15264 |
| 118 | Ga0453684_0049571 | 3300044712 | Bacteria | 5535 |
| 119 | Ga0453684_0067349 | 3300044712 | Bacteria | 4553 |
| 120 | Ga0453684_0276978 | 3300044712 | Bacteria | 1915 |
| 121 | Ga0453684_0277067 | 3300044712 | Bacteria | 1914 |
| 122 | Ga0453684_0348989 | 3300044712 | Bacteria | 1669 |
| 123 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 124 | Ga0451576_0001076 | 3300045051 | Bacteria | 50068 |
| 125 | Ga0451576_0007974 | 3300045051 | Bacteria | 12523 |
| 126 | Ga0451576_0008656 | 3300045051 | Bacteria | 11917 |
| 127 | Ga0451576_0061535 | 3300045051 | Bacteria | 3914 |
| 128 | Ga0451576_0062045 | 3300045051 | Bacteria | 3897 |
| 129 | Ga0451576_0078190 | 3300045051 | Bacteria | 3443 |
| 130 | Ga0451576_0079842 | 3300045051 | Bacteria | 3404 |
| 131 | Ga0451576_0341106 | 3300045051 | Bacteria | 1569 |
| 132 | Ga0451576_0418684 | 3300045051 | Bacteria | 1405 |
| 133 | Ga0495586_0034019 | 3300046535 | Bacteria | 2736 |
| 134 | Ga0501033_0080551 | 3300049570 | Bacteria | 2389 |
| 135 | Ga0501038_0146036 | 3300049574 | Bacteria | 1931 |
| 136 | Ga0501038_0272476 | 3300049574 | Bacteria | 1334 |
| 137 | Ga0501040_0111841 | 3300049576 | Bacteria | 1910 |
| 138 | Ga0501041_0007501 | 3300049577 | Bacteria | 6401 |
| 139 | Ga0501041_0233103 | 3300049577 | Bacteria | 1156 |
| 140 | Ga0501042_0228773 | 3300049578 | Bacteria | 1341 |
| 141 | Ga0501046_0025685 | 3300049580 | Bacteria | 4818 |
| 142 | Ga0501046_0187423 | 3300049580 | Bacteria | 1545 |
| 143 | Ga0501048_0023067 | 3300049582 | Bacteria | 4549 |
| 144 | Ga0501071_0006723 | 3300049587 | Bacteria | 7480 |
| 145 | Ga0501072_0014542 | 3300049588 | Bacteria | 6030 |
| 146 | Ga0501072_0017327 | 3300049588 | Bacteria | 5535 |
| 147 | Ga0501074_0121869 | 3300049590 | Bacteria | 1865 |
| 148 | Ga0501075_0116895 | 3300049591 | Bacteria | 2027 |
| 149 | Ga0501076_0000535 | 3300049592 | Bacteria | 24232 |
| 150 | Ga0501076_0050905 | 3300049592 | Bacteria | 3277 |
| 151 | Ga0501077_0020284 | 3300049593 | Bacteria | 4207 |
| 152 | Ga0501077_0022540 | 3300049593 | Bacteria | 3989 |
| 153 | Ga0501079_0004263 | 3300049741 | Bacteria | 10610 |
| 154 | Ga0501079_0027310 | 3300049741 | Bacteria | 4375 |
| 155 | Ga0501080_0010091 | 3300049742 | Bacteria | 8635 |
| 156 | Ga0501080_0026361 | 3300049742 | Bacteria | 5401 |
| 157 | Ga0501081_0126640 | 3300049743 | Bacteria | 1822 |
| 158 | Ga0501083_0333502 | 3300049744 | Bacteria | 986 |
| 159 | Ga0501035_0084463 | 3300049822 | Bacteria | 2800 |
| 160 | Ga0501045_0000126 | 3300049824 | Bacteria | 40036 |
| 161 | Ga0501084_0010373 | 3300054114 | Bacteria | 7707 |
| 162 | Ga0501082_0003598 | 3300060353 | Bacteria | 13538 |
| 163 | Ga0501082_0283064 | 3300060353 | Bacteria | 1443 |
| 164 | Ga0530510_0000258 | 3300061734 | Bacteria | 33289 |
| 165 | Ga0530510_0002004 | 3300061734 | Bacteria | 13980 |
| 166 | Ga0316588_1000686 | |||
| 167 | Ga0065707_10085058 | |||
| 168 | Ga0265336_10003160 | |||
| 169 | Ga0265324_10000005 | |||
| 170 | Ga0265325_10008145 | |||
| 171 | Ga0265331_10015536 | |||
| 172 | Ga0265327_10101519 | |||
| 173 | Ga0265316_10164624 | |||
| 174 | Ga0265313_10000346 | |||
| 175 | Ga0316575_10002255 | |||
| 176 | Ga0316575_10025859 | |||
| 177 | Ga0316575_10036997 | |||
| 178 | Ga0316575_10041842 | |||
| 179 | Ga0265314_10065063 | |||
| 180 | Ga0316576_10014828 | |||
| 181 | Ga0316576_10017441 | |||
| 182 | Ga0316576_10037283 | |||
| 183 | Ga0316576_10084878 | |||
| 184 | Ga0316576_10194252 | |||
| 185 | Ga0316576_10241230 | |||
| 186 | Ga0316578_10048293 | |||
| 187 | Ga0316578_10071758 | |||
| 188 | Ga0316578_10104437 | |||
| 189 | Ga0316577_10020344 | |||
| 190 | Ga0316577_10034507 | |||
| 191 | Ga0316577_10137288 | |||
| 192 | Ga0316583_10004318 | |||
| 193 | Ga0316583_10009872 | |||
| 194 | Ga0316585_10052906 | |||
| 195 | Ga0316580_10003963 | |||
| 196 | Ga0316580_10004859 | |||
| 197 | Ga0316593_10000057 | |||
| 198 | Ga0316593_10000066 | |||
| 199 | Ga0316593_10000078 | |||
| 200 | Ga0316593_10000317 | |||
| 201 | Ga0316593_10000522 | |||
| 202 | Ga0316593_10001991 | |||
| 203 | Ga0316593_10004772 | |||
| 204 | Ga0316593_10005339 | |||
| 205 | Ga0316593_10005488 | |||
| 206 | Ga0316593_10006991 | |||
| 207 | Ga0316593_10016793 | |||
| 208 | Ga0316593_10019449 | |||
| 209 | Ga0316593_10026772 | |||
| 210 | Ga0316593_10085250 | |||
| 211 | Ga0316593_10143581 | |||
| 212 | Ga0316592_1002883 | |||
| 213 | Ga0316592_1009946 | |||
| 214 | Ga0316592_1011528 | |||
| 215 | Ga0316592_1021088 | |||
| 216 | Ga0316586_1000085 | |||
| 217 | Ga0316586_1000687 | |||
| 218 | Ga0316586_1001040 | |||
| 219 | Ga0316586_1002713 | |||
| 220 | Ga0316588_1003311 | |||
| 221 | Ga0316588_1004645 | |||
| 222 | Ga0316588_1005188 | |||
| 223 | Ga0316588_1014430 | |||
| 224 | Ga0316587_1000257 | |||
| 225 | Ga0316587_1000617 | |||
| 226 | Ga0316587_1007574 | |||
| 227 | Ga0316596_1000113 | |||
| 228 | Ga0316596_1000299 | |||
| 229 | Ga0316596_1003020 | |||
| 230 | Ga0316596_1005042 | |||
| 231 | Ga0316596_1005524 | |||
| 232 | Ga0316596_1008577 | |||
| 233 | Ga0316596_1009162 | |||
| 234 | Ga0316596_1009679 | |||
| 235 | Ga0316596_1011833 | |||
| 236 | Ga0316596_1011944 | |||
| 237 | Ga0316596_1013011 | |||
| 238 | Ga0316596_1016325 | |||
| 239 | Ga0316596_1073992 | |||
| 240 | Ga0373951_0019965 | |||
| 241 | Ga0316574_0008415 | |||
| 242 | Ga0316574_0010207 | |||
| 243 | Ga0316574_0015247 | |||
| 244 | Ga0316574_0048692 | |||
| 245 | Ga0316574_0050674 | |||
| 246 | Ga0316574_0221595 | |||
| 247 | Ga0373924_0000584 | |||
| 248 | Ga0316582_0047730 | |||
| 249 | Ga0316582_0080440 | |||
| 250 | Ga0316582_0090050 | |||
| 251 | Ga0316582_0094246 | |||
| 252 | Ga0316582_0108692 | |||
| 253 | Ga0316582_0161432 | |||
| 254 | Ga0316582_0179986 | |||
| 255 | Ga0316582_0286906 | |||
| 256 | Ga0316584_0020862 | |||
| 257 | Ga0316584_0038370 | |||
| 258 | Ga0316584_0041454 | |||
| 259 | Ga0316584_0055175 | |||
| 260 | Ga0316584_0071835 | |||
| 261 | Ga0316584_0110512 | |||
| 262 | Ga0395899_0138395 | |||
| 263 | Ga0395900_0015964 | |||
| 264 | Ga0395905_0043287 | |||
| 265 | Ga0439435_0000113 | |||
| 266 | Ga0451577_0000002 | |||
| 267 | Ga0451577_0000613 | |||
| 268 | Ga0451577_0002704 | |||
| 269 | Ga0451577_0038670 | |||
| 270 | Ga0451577_0178323 | |||
| 271 | Ga0451577_0463293 | |||
| 272 | Ga0453683_0000003 | |||
| 273 | Ga0453683_0011037 | |||
| 274 | Ga0453683_0029423 | |||
| 275 | Ga0453683_0143260 | |||
| 276 | Ga0453684_0000002 | |||
| 277 | Ga0453684_0000005 | |||
| 278 | Ga0453684_0000029 | |||
| 279 | Ga0453684_0000048 | |||
| 280 | Ga0453684_0000077 | |||
| 281 | Ga0453684_0003047 | |||
| 282 | Ga0453684_0011034 | |||
| 283 | Ga0453684_0049571 | |||
| 284 | Ga0453684_0067349 | |||
| 285 | Ga0453684_0276978 | |||
| 286 | Ga0453684_0277067 | |||
| 287 | Ga0453684_0348989 | |||
| 288 | Ga0451576_0000004 | |||
| 289 | Ga0451576_0001076 | |||
| 290 | Ga0451576_0007974 | |||
| 291 | Ga0451576_0008656 | |||
| 292 | Ga0451576_0061535 | |||
| 293 | Ga0451576_0062045 | |||
| 294 | Ga0451576_0078190 | |||
| 295 | Ga0451576_0079842 | |||
| 296 | Ga0451576_0341106 | |||
| 297 | Ga0451576_0418684 | |||
| 298 | Ga0495586_0034019 | |||
| 299 | Ga0501033_0080551 | |||
| 300 | Ga0501038_0146036 | |||
| 301 | Ga0501038_0272476 | |||
| 302 | Ga0501040_0111841 | |||
| 303 | Ga0501041_0007501 | |||
| 304 | Ga0501041_0233103 | |||
| 305 | Ga0501042_0228773 | |||
| 306 | Ga0501046_0025685 | |||
| 307 | Ga0501046_0187423 | |||
| 308 | Ga0501048_0023067 | |||
| 309 | Ga0501071_0006723 | |||
| 310 | Ga0501072_0014542 | |||
| 311 | Ga0501072_0017327 | |||
| 312 | Ga0501074_0121869 | |||
| 313 | Ga0501075_0116895 | |||
| 314 | Ga0501076_0000535 | |||
| 315 | Ga0501076_0050905 | |||
| 316 | Ga0501077_0020284 | |||
| 317 | Ga0501077_0022540 | |||
| 318 | Ga0501079_0004263 | |||
| 319 | Ga0501079_0027310 | |||
| 320 | Ga0501080_0010091 | |||
| 321 | Ga0501080_0026361 | |||
| 322 | Ga0501081_0126640 | |||
| 323 | Ga0501083_0333502 | |||
| 324 | Ga0501035_0084463 | |||
| 325 | Ga0501045_0000126 | |||
| 326 | Ga0501084_0010373 | |||
| 327 | Ga0501082_0003598 | |||
| 328 | Ga0501082_0283064 | |||
| 329 | Ga0530510_0000258 | |||
| 330 | Ga0530510_0002004 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y5i-assembly1.cif.gz_C | the crystal structure of the narghi mutant nari-k86a | 0.7262 | 11 | 211 |
| 1y4z-assembly1.cif.gz_C | the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol | 0.7259 | 11 | 211 |
| 1y5n-assembly1.cif.gz_C | the crystal structure of the narghi mutant nari-k86a in complex with pentachlorophenol | 0.6931 | 11 | 211 |
| 1siw-assembly1.cif.gz_C | crystal structure of the apomolybdo-narghi | 0.6836 | 11 | 211 |
| 3ir5-assembly1.cif.gz_C | crystal structure of narghi mutant narg-h49c | 0.6782 | 11 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1siwC01 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6836 | 11 | 211 | 1.20.950.20 |
| af_Q2FVM4_1_215_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.683 | 10 | 215 | 1.20.950.20 |
| af_O06562_6_220_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6516 | 5 | 212 | 1.20.950.20 |
| af_Q2FVM4_1_215_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6363 | 10 | 215 | 1.20.950.20 |
| 1siwC01 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6178 | 11 | 211 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3X1Y8-F1-model_v4 | Nitrate reductase | 0.9709 | 1 | 225 |
GO:0005886
GO:0016491 |
| AF-A0A3B1BBD4-F1-model_v4 | Sulfite reduction-associated complex DsrMKJOP protein DsrM (= HmeC) | 0.9665 | 2 | 228 |
GO:0005886
GO:0016491 |
| AF-A0A1F3X1Y8-F1-model_v4 | Nitrate reductase | 0.9625 | 1 | 225 |
GO:0005886
GO:0016491 |
| AF-A0A3B1BBD4-F1-model_v4 | Sulfite reduction-associated complex DsrMKJOP protein DsrM (= HmeC) | 0.9582 | 2 | 228 |
GO:0005886
GO:0016491 |
| AF-I3CF67-F1-model_v4 | Nitrate reductase gamma subunit | 0.9532 | 4 | 228 |
GO:0005886
GO:0008940 GO:0009055 GO:0019645 GO:0020037 |