F247102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 95 | 330 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0000405|Ga0501038_0000405_31222_32058 |
| Length | 278 |
| Sequence | MQRMDTPETSEISSSSPATEPSIAGREEIVRTIDVVKEYKLAAAAKEDGGASGAGDNGVSRVLKGINLTIYKGEYISIMGPSGSGKSTLFNAIGGLDKPTSGKVFIDEVDVAQLDALELAWLRCRKIGYIFQTFNLIPVMTALENVALPMIFAGLSTTAAQEKAAGILRRVELGHRLFNRPSQLSGGQQQRVAIARAFANDPAIILADEPTGNLDLNTGKAIIGLLREMNKERGVTIISATHDFKMLDVSDRIIWIRDGQIDKIQRREEVDIRTGEIH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 9 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 12 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 13 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 14 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 22 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 29 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 30 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 31 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 32 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 33 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 34 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 35 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 36 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 37 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 38 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 39 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 40 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 41 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 42 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 43 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 44 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 45 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 46 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 47 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 48 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 49 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 51 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 52 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 53 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 54 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 55 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 56 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 57 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 58 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 59 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 60 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 61 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 62 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 63 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 64 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 65 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 66 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 67 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 68 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 69 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 70 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 71 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 72 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 73 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 77 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 78 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 79 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 80 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 81 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 83 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 84 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 85 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 86 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 87 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 88 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 89 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 90 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 91 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 92 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 93 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 94 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 95 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 1.21 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.21 |
| Rhizosphere | 86.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501038_0000405 | 3300049574 | Bacteria | 37444 |
| 2 | Ga0070670_100056604 | 3300005331 | Bacteria | 3365 |
| 3 | Ga0070675_100025887 | 3300005354 | Bacteria | 4705 |
| 4 | Ga0070667_100625597 | 3300005367 | Bacteria | 993 |
| 5 | Ga0070701_10354708 | 3300005438 | Bacteria | 917 |
| 6 | Ga0070678_100532188 | 3300005456 | Bacteria | 1041 |
| 7 | Ga0070665_100001093 | 3300005548 | Bacteria | 33580 |
| 8 | Ga0068859_100674394 | 3300005617 | Bacteria | 1125 |
| 9 | Ga0081539_10019253 | 3300005985 | Bacteria | 4682 |
| 10 | Ga0070717_10021749 | 3300006028 | Bacteria | 5059 |
| 11 | Ga0075428_100066578 | 3300006844 | Bacteria | 3944 |
| 12 | Ga0075431_100142886 | 3300006847 | Bacteria | 2467 |
| 13 | Ga0075429_100025579 | 3300006880 | Bacteria | 5124 |
| 14 | Ga0075429_100045743 | 3300006880 | Bacteria | 3808 |
| 15 | Ga0097620_100674231 | 3300006931 | Bacteria | 1125 |
| 16 | Ga0114129_10016058 | 3300009147 | Bacteria | 10651 |
| 17 | Ga0105248_10161600 | 3300009177 | Bacteria | 2526 |
| 18 | Ga0105249_10588097 | 3300009553 | Bacteria | 1167 |
| 19 | Ga0157372_10109149 | 3300013307 | Bacteria | 3168 |
| 20 | Ga0157379_10129514 | 3300014968 | Bacteria | 2271 |
| 21 | Ga0163161_10111568 | 3300017792 | Bacteria | 2045 |
| 22 | Ga0163161_10309340 | 3300017792 | Bacteria | 1246 |
| 23 | Ga0213875_10000082 | 3300021388 | Bacteria | 112075 |
| 24 | Ga0207705_10001155 | 3300025909 | Bacteria | 21465 |
| 25 | Ga0207650_10060435 | 3300025925 | Bacteria | 2828 |
| 26 | Ga0207659_10039634 | 3300025926 | Bacteria | 3288 |
| 27 | Ga0207711_10104793 | 3300025941 | Bacteria | 2507 |
| 28 | Ga0268266_10009744 | 3300028379 | Bacteria | 8449 |
| 29 | Ga0268265_10236623 | 3300028380 | Bacteria | 1609 |
| 30 | Ga0265318_10026911 | 3300028577 | Bacteria | 2263 |
| 31 | Ga0265318_10029137 | 3300028577 | Bacteria | 2154 |
| 32 | Ga0265322_10048076 | 3300028654 | Bacteria | 1212 |
| 33 | Ga0265338_10002403 | 3300028800 | Bacteria | 28165 |
| 34 | Ga0265332_10031343 | 3300031238 | Bacteria | 2319 |
| 35 | Ga0265325_10060602 | 3300031241 | Bacteria | 1922 |
| 36 | Ga0265329_10055896 | 3300031242 | Bacteria | 1252 |
| 37 | Ga0265339_10015521 | 3300031249 | Bacteria | 4562 |
| 38 | Ga0265316_10002849 | 3300031344 | Bacteria | 17699 |
| 39 | Ga0265316_10049159 | 3300031344 | Bacteria | 3323 |
| 40 | Ga0316575_10000920 | 3300031665 | Bacteria | 9051 |
| 41 | Ga0316575_10011326 | 3300031665 | Bacteria | 3298 |
| 42 | Ga0316575_10066775 | 3300031665 | Bacteria | 1441 |
| 43 | Ga0316575_10069096 | 3300031665 | Bacteria | 1417 |
| 44 | Ga0316575_10084211 | 3300031665 | Bacteria | 1284 |
| 45 | Ga0316579_10006711 | 3300031691 | Bacteria | 4712 |
| 46 | Ga0316579_10007907 | 3300031691 | Bacteria | 4410 |
| 47 | Ga0316579_10047236 | 3300031691 | Bacteria | 2010 |
| 48 | Ga0265314_10001872 | 3300031711 | Bacteria | 22556 |
| 49 | Ga0265314_10002264 | 3300031711 | Bacteria | 19926 |
| 50 | Ga0265342_10123141 | 3300031712 | Bacteria | 1458 |
| 51 | Ga0316576_10002851 | 3300031727 | Bacteria | 9964 |
| 52 | Ga0316576_10017347 | 3300031727 | Bacteria | 4888 |
| 53 | Ga0316576_10020835 | 3300031727 | Bacteria | 4523 |
| 54 | Ga0316576_10067697 | 3300031727 | Bacteria | 2629 |
| 55 | Ga0316578_10003975 | 3300031728 | Bacteria | 6891 |
| 56 | Ga0316578_10011521 | 3300031728 | Bacteria | 4632 |
| 57 | Ga0316578_10020302 | 3300031728 | Bacteria | 3669 |
| 58 | Ga0316578_10022584 | 3300031728 | Bacteria | 3509 |
| 59 | Ga0316578_10045663 | 3300031728 | Bacteria | 2551 |
| 60 | Ga0316578_10061727 | 3300031728 | Bacteria | 2209 |
| 61 | Ga0316578_10070195 | 3300031728 | Bacteria | 2073 |
| 62 | Ga0316578_10140420 | 3300031728 | Bacteria | 1455 |
| 63 | Ga0307405_10319287 | 3300031731 | Bacteria | 1186 |
| 64 | Ga0316577_10000985 | 3300031733 | Bacteria | 12720 |
| 65 | Ga0316577_10015161 | 3300031733 | Bacteria | 4239 |
| 66 | Ga0316577_10044190 | 3300031733 | Bacteria | 2492 |
| 67 | Ga0307412_10206131 | 3300031911 | Bacteria | 1497 |
| 68 | Ga0307409_100062826 | 3300031995 | Bacteria | 2909 |
| 69 | Ga0307409_100296869 | 3300031995 | Bacteria | 1501 |
| 70 | Ga0316583_10043955 | 3300032133 | Bacteria | 1579 |
| 71 | Ga0316583_10075854 | 3300032133 | Bacteria | 1175 |
| 72 | Ga0316585_10000593 | 3300032137 | Bacteria | 8854 |
| 73 | Ga0316585_10000602 | 3300032137 | Bacteria | 8803 |
| 74 | Ga0316585_10026574 | 3300032137 | Bacteria | 1801 |
| 75 | Ga0316585_10031160 | 3300032137 | Bacteria | 1676 |
| 76 | Ga0316580_10002971 | 3300032139 | Bacteria | 4760 |
| 77 | Ga0316580_10088982 | 3300032139 | Bacteria | 945 |
| 78 | Ga0316586_1005760 | 3300033527 | Bacteria | 1755 |
| 79 | Ga0316588_1011217 | 3300033528 | Bacteria | 1906 |
| 80 | Ga0373941_0086124 | 3300035115 | Bacteria | 1070 |
| 81 | Ga0373960_0152069 | 3300035121 | Bacteria | 791 |
| 82 | Ga0373961_0027557 | 3300035241 | Bacteria | 1561 |
| 83 | Ga0316574_0000843 | 3300035398 | Bacteria | 13423 |
| 84 | Ga0316574_0003094 | 3300035398 | Bacteria | 8495 |
| 85 | Ga0316574_0016442 | 3300035398 | Bacteria | 4312 |
| 86 | Ga0316574_0025066 | 3300035398 | Bacteria | 3577 |
| 87 | Ga0316574_0465690 | 3300035398 | Bacteria | 791 |
| 88 | Ga0373931_0223051 | 3300035691 | Bacteria | 1136 |
| 89 | Ga0373927_0000853 | 3300035695 | Bacteria | 23252 |
| 90 | Ga0373927_0001411 | 3300035695 | Bacteria | 18121 |
| 91 | Ga0316582_0003108 | 3300036647 | Bacteria | 8037 |
| 92 | Ga0316582_0008998 | 3300036647 | Bacteria | 5396 |
| 93 | Ga0316582_0038177 | 3300036647 | Bacteria | 2983 |
| 94 | Ga0316582_0042879 | 3300036647 | Bacteria | 2836 |
| 95 | Ga0316582_0056365 | 3300036647 | Bacteria | 2507 |
| 96 | Ga0316582_0068525 | 3300036647 | Bacteria | 2291 |
| 97 | Ga0316582_0072346 | 3300036647 | Bacteria | 2235 |
| 98 | Ga0316582_0083687 | 3300036647 | Bacteria | 2088 |
| 99 | Ga0316582_0173859 | 3300036647 | Bacteria | 1463 |
| 100 | Ga0316582_0178576 | 3300036647 | Bacteria | 1444 |
| 101 | Ga0316584_0000536 | 3300036712 | Bacteria | 20312 |
| 102 | Ga0316584_0005960 | 3300036712 | Bacteria | 8229 |
| 103 | Ga0316584_0017281 | 3300036712 | Bacteria | 5182 |
| 104 | Ga0316584_0022044 | 3300036712 | Bacteria | 4641 |
| 105 | Ga0316584_0027798 | 3300036712 | Bacteria | 4165 |
| 106 | Ga0316584_0045023 | 3300036712 | Bacteria | 3292 |
| 107 | Ga0316584_0054730 | 3300036712 | Bacteria | 2987 |
| 108 | Ga0316584_0076540 | 3300036712 | Bacteria | 2507 |
| 109 | Ga0316584_0093241 | 3300036712 | Bacteria | 2255 |
| 110 | Ga0316584_0097152 | 3300036712 | Bacteria | 2205 |
| 111 | Ga0316584_0178057 | 3300036712 | Bacteria | 1575 |
| 112 | Ga0316584_0288042 | 3300036712 | Bacteria | 1192 |
| 113 | Ga0316584_0297724 | 3300036712 | Bacteria | 1169 |
| 114 | Ga0373925_0001144 | 3300037068 | Bacteria | 23549 |
| 115 | Ga0373925_0001509 | 3300037068 | Bacteria | 19927 |
| 116 | Ga0316581_0056765 | 3300037588 | Bacteria | 1200 |
| 117 | Ga0436364_0900039 | 3300037853 | Bacteria | 109765 |
| 118 | Ga0400484_27577 | 3300038725 | Bacteria | 6423 |
| 119 | Ga0400490_42180 | 3300038726 | Bacteria | 9503 |
| 120 | Ga0400491_03110 | 3300038727 | Bacteria | 2153 |
| 121 | Ga0400485_11374 | 3300038735 | Bacteria | 75370 |
| 122 | Ga0400488_28743 | 3300038741 | Bacteria | 2119 |
| 123 | Ga0400488_31963 | 3300038741 | Bacteria | 2415 |
| 124 | Ga0400488_33639 | 3300038741 | Bacteria | 2055 |
| 125 | Ga0400486_10961 | 3300038742 | Bacteria | 98465 |
| 126 | Ga0400483_002047 | 3300039062 | Bacteria | 2040 |
| 127 | Ga0400483_087665 | 3300039062 | Bacteria | 5205 |
| 128 | Ga0400483_165697 | 3300039062 | Bacteria | 3106 |
| 129 | Ga0400483_183848 | 3300039062 | Bacteria | 1326 |
| 130 | Ga0400483_189338 | 3300039062 | Bacteria | 7444 |
| 131 | Ga0400489_39280 | 3300039093 | Bacteria | 7120 |
| 132 | Ga0400489_67104 | 3300039093 | Bacteria | 22090 |
| 133 | Ga0400489_91832 | 3300039093 | Bacteria | 2729 |
| 134 | Ga0400489_93013 | 3300039093 | Bacteria | 1068 |
| 135 | Ga0400487_57720 | 3300039110 | Bacteria | 20772 |
| 136 | Ga0451577_0254407 | 3300042876 | Bacteria | 1590 |
| 137 | Ga0453684_0007229 | 3300044712 | Bacteria | 20587 |
| 138 | Ga0453684_0223629 | 3300044712 | Bacteria | 2179 |
| 139 | Ga0495630_0652280 | 3300046517 | Bacteria | 806 |
| 140 | Ga0495684_0057161 | 3300047471 | Bacteria | 2974 |
| 141 | Ga0495614_0147045 | 3300048089 | Bacteria | 1050 |
| 142 | Ga0496100_0565533 | 3300048903 | Bacteria | 881 |
| 143 | Ga0501034_0000565 | 3300049571 | Bacteria | 58696 |
| 144 | Ga0501034_0000594 | 3300049571 | Bacteria | 57193 |
| 145 | Ga0501036_0054755 | 3300049572 | Bacteria | 3380 |
| 146 | Ga0501043_0004503 | 3300049579 | Bacteria | 11323 |
| 147 | Ga0501043_0201923 | 3300049579 | Bacteria | 1543 |
| 148 | Ga0501043_0313490 | 3300049579 | Bacteria | 1197 |
| 149 | Ga0501046_0000044 | 3300049580 | Bacteria | 151271 |
| 150 | Ga0501047_0175460 | 3300049581 | Bacteria | 2010 |
| 151 | Ga0501048_0004312 | 3300049582 | Bacteria | 10841 |
| 152 | Ga0501075_0277528 | 3300049591 | Bacteria | 1277 |
| 153 | Ga0501252_030413 | 3300049682 | Bacteria | 746 |
| 154 | Ga0501079_0200470 | 3300049741 | Bacteria | 1559 |
| 155 | Ga0501080_0676259 | 3300049742 | Bacteria | 912 |
| 156 | Ga0501083_0000008 | 3300049744 | Bacteria | 197749 |
| 157 | Ga0501035_0043631 | 3300049822 | Bacteria | 4040 |
| 158 | Ga0501035_0296754 | 3300049822 | Bacteria | 1363 |
| 159 | Ga0501044_0017228 | 3300049823 | Bacteria | 7749 |
| 160 | nmdc:mga05p37_9670_c1 | 3300050507 | Bacteria | 11428 |
| 161 | nmdc:mga09592_42203_c1 | 3300050508 | Bacteria | 3837 |
| 162 | Ga0501084_0200422 | 3300054114 | Bacteria | 1684 |
| 163 | Ga0501082_0383207 | 3300060353 | Bacteria | 1227 |
| 164 | 2740991344 | 2740891818 | Bacteria | 6711283 |
| 165 | 2787433988 | 2786546517 | Bacteria | 6614109 |
| 166 | Ga0501038_0000405 | |||
| 167 | Ga0070670_100056604 | |||
| 168 | Ga0070675_100025887 | |||
| 169 | Ga0070667_100625597 | |||
| 170 | Ga0070701_10354708 | |||
| 171 | Ga0070678_100532188 | |||
| 172 | Ga0070665_100001093 | |||
| 173 | Ga0068859_100674394 | |||
| 174 | Ga0081539_10019253 | |||
| 175 | Ga0070717_10021749 | |||
| 176 | Ga0075428_100066578 | |||
| 177 | Ga0075431_100142886 | |||
| 178 | Ga0075429_100025579 | |||
| 179 | Ga0075429_100045743 | |||
| 180 | Ga0097620_100674231 | |||
| 181 | Ga0114129_10016058 | |||
| 182 | Ga0105248_10161600 | |||
| 183 | Ga0105249_10588097 | |||
| 184 | Ga0157372_10109149 | |||
| 185 | Ga0157379_10129514 | |||
| 186 | Ga0163161_10111568 | |||
| 187 | Ga0163161_10309340 | |||
| 188 | Ga0213875_10000082 | |||
| 189 | Ga0207705_10001155 | |||
| 190 | Ga0207650_10060435 | |||
| 191 | Ga0207659_10039634 | |||
| 192 | Ga0207711_10104793 | |||
| 193 | Ga0268266_10009744 | |||
| 194 | Ga0268265_10236623 | |||
| 195 | Ga0265318_10026911 | |||
| 196 | Ga0265318_10029137 | |||
| 197 | Ga0265322_10048076 | |||
| 198 | Ga0265338_10002403 | |||
| 199 | Ga0265332_10031343 | |||
| 200 | Ga0265325_10060602 | |||
| 201 | Ga0265329_10055896 | |||
| 202 | Ga0265339_10015521 | |||
| 203 | Ga0265316_10002849 | |||
| 204 | Ga0265316_10049159 | |||
| 205 | Ga0316575_10000920 | |||
| 206 | Ga0316575_10011326 | |||
| 207 | Ga0316575_10066775 | |||
| 208 | Ga0316575_10069096 | |||
| 209 | Ga0316575_10084211 | |||
| 210 | Ga0316579_10006711 | |||
| 211 | Ga0316579_10007907 | |||
| 212 | Ga0316579_10047236 | |||
| 213 | Ga0265314_10001872 | |||
| 214 | Ga0265314_10002264 | |||
| 215 | Ga0265342_10123141 | |||
| 216 | Ga0316576_10002851 | |||
| 217 | Ga0316576_10017347 | |||
| 218 | Ga0316576_10020835 | |||
| 219 | Ga0316576_10067697 | |||
| 220 | Ga0316578_10003975 | |||
| 221 | Ga0316578_10011521 | |||
| 222 | Ga0316578_10020302 | |||
| 223 | Ga0316578_10022584 | |||
| 224 | Ga0316578_10045663 | |||
| 225 | Ga0316578_10061727 | |||
| 226 | Ga0316578_10070195 | |||
| 227 | Ga0316578_10140420 | |||
| 228 | Ga0307405_10319287 | |||
| 229 | Ga0316577_10000985 | |||
| 230 | Ga0316577_10015161 | |||
| 231 | Ga0316577_10044190 | |||
| 232 | Ga0307412_10206131 | |||
| 233 | Ga0307409_100062826 | |||
| 234 | Ga0307409_100296869 | |||
| 235 | Ga0316583_10043955 | |||
| 236 | Ga0316583_10075854 | |||
| 237 | Ga0316585_10000593 | |||
| 238 | Ga0316585_10000602 | |||
| 239 | Ga0316585_10026574 | |||
| 240 | Ga0316585_10031160 | |||
| 241 | Ga0316580_10002971 | |||
| 242 | Ga0316580_10088982 | |||
| 243 | Ga0316586_1005760 | |||
| 244 | Ga0316588_1011217 | |||
| 245 | Ga0373941_0086124 | |||
| 246 | Ga0373960_0152069 | |||
| 247 | Ga0373961_0027557 | |||
| 248 | Ga0316574_0000843 | |||
| 249 | Ga0316574_0003094 | |||
| 250 | Ga0316574_0016442 | |||
| 251 | Ga0316574_0025066 | |||
| 252 | Ga0316574_0465690 | |||
| 253 | Ga0373931_0223051 | |||
| 254 | Ga0373927_0000853 | |||
| 255 | Ga0373927_0001411 | |||
| 256 | Ga0316582_0003108 | |||
| 257 | Ga0316582_0008998 | |||
| 258 | Ga0316582_0038177 | |||
| 259 | Ga0316582_0042879 | |||
| 260 | Ga0316582_0056365 | |||
| 261 | Ga0316582_0068525 | |||
| 262 | Ga0316582_0072346 | |||
| 263 | Ga0316582_0083687 | |||
| 264 | Ga0316582_0173859 | |||
| 265 | Ga0316582_0178576 | |||
| 266 | Ga0316584_0000536 | |||
| 267 | Ga0316584_0005960 | |||
| 268 | Ga0316584_0017281 | |||
| 269 | Ga0316584_0022044 | |||
| 270 | Ga0316584_0027798 | |||
| 271 | Ga0316584_0045023 | |||
| 272 | Ga0316584_0054730 | |||
| 273 | Ga0316584_0076540 | |||
| 274 | Ga0316584_0093241 | |||
| 275 | Ga0316584_0097152 | |||
| 276 | Ga0316584_0178057 | |||
| 277 | Ga0316584_0288042 | |||
| 278 | Ga0316584_0297724 | |||
| 279 | Ga0373925_0001144 | |||
| 280 | Ga0373925_0001509 | |||
| 281 | Ga0316581_0056765 | |||
| 282 | Ga0436364_0900039 | |||
| 283 | Ga0400484_27577 | |||
| 284 | Ga0400490_42180 | |||
| 285 | Ga0400491_03110 | |||
| 286 | Ga0400485_11374 | |||
| 287 | Ga0400488_28743 | |||
| 288 | Ga0400488_31963 | |||
| 289 | Ga0400488_33639 | |||
| 290 | Ga0400486_10961 | |||
| 291 | Ga0400483_002047 | |||
| 292 | Ga0400483_087665 | |||
| 293 | Ga0400483_165697 | |||
| 294 | Ga0400483_183848 | |||
| 295 | Ga0400483_189338 | |||
| 296 | Ga0400489_39280 | |||
| 297 | Ga0400489_67104 | |||
| 298 | Ga0400489_91832 | |||
| 299 | Ga0400489_93013 | |||
| 300 | Ga0400487_57720 | |||
| 301 | Ga0451577_0254407 | |||
| 302 | Ga0453684_0007229 | |||
| 303 | Ga0453684_0223629 | |||
| 304 | Ga0495630_0652280 | |||
| 305 | Ga0495684_0057161 | |||
| 306 | Ga0495614_0147045 | |||
| 307 | Ga0496100_0565533 | |||
| 308 | Ga0501034_0000565 | |||
| 309 | Ga0501034_0000594 | |||
| 310 | Ga0501036_0054755 | |||
| 311 | Ga0501043_0004503 | |||
| 312 | Ga0501043_0201923 | |||
| 313 | Ga0501043_0313490 | |||
| 314 | Ga0501046_0000044 | |||
| 315 | Ga0501047_0175460 | |||
| 316 | Ga0501048_0004312 | |||
| 317 | Ga0501075_0277528 | |||
| 318 | Ga0501252_030413 | |||
| 319 | Ga0501079_0200470 | |||
| 320 | Ga0501080_0676259 | |||
| 321 | Ga0501083_0000008 | |||
| 322 | Ga0501035_0043631 | |||
| 323 | Ga0501035_0296754 | |||
| 324 | Ga0501044_0017228 | |||
| 325 | nmdc:mga05p37_9670_c1 | |||
| 326 | nmdc:mga09592_42203_c1 | |||
| 327 | Ga0501084_0200422 | |||
| 328 | Ga0501082_0383207 | |||
| 329 | 2740991344 | |||
| 330 | 2787433988 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9772 | 17 | 242 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9749 | 17 | 239 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9726 | 17 | 239 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9725 | 18 | 241 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9643 | 17 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T664_36_360_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9803 | 17 | 241 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9796 | 45 | 241 | 3.40.50.300 |
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9795 | 16 | 240 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9793 | 14 | 236 | 3.40.50.300 |
| af_P9WQK1_1_231_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9782 | 14 | 236 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H8FG51-F1-model_v4 | deleted | 0.9874 | 17 | 218 |
|
| AF-X1I1Q5-F1-model_v4 | ABC transporter domain-containing protein | 0.9818 | 69 | 204 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
| AF-A0A377TL40-F1-model_v4 | Methionine ABC transporter ATP-binding protein (EC 3.6.3.-) | 0.9811 | 69 | 208 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A1F8CYG4-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.98 | 54 | 240 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A0J6SXG5-F1-model_v4 | Methionine ABC transporter ATP-binding protein | 0.9799 | 54 | 241 |
GO:0005524
GO:0006865 GO:0016887 |