F247113

General Info

Members Datasets Scaffolds Average Seq Length
165 119 330 261

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0146876|Ga0501042_0146876_114_977
Length 287
Sequence VSDLRKSRDNGNSPGGGSSRGHLLRRHAPITDKAWSEIDDEARDRLQPALAARKLVDFEGPLGWEHSATNLGRVQAVEGEHVTGVQALQRRVLPLVELRAPFTVSRDELRDIDRGAVDADFESLDAAAQRLAVAENQAVFHGLAASGVEGVCQATTHPTIELNGDGYDRYPTHVARAVEMLLSAGIEGPYGLAVSPEGYTGVIETTERGGYPLLDHLKKIVGGPLVWAPGVTGAVVVSLRGGDFLFESGQDISVGYDSHDADVVNLYLEESFSFRVATPEAAVALVP

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
116 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 2857729791 Plantibacter sp. R-72288 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 18.18
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0146876 3300049578 Bacteria 1700
2 Ga0070683_100230026 3300005329 Bacteria 1763
3 Ga0070683_100397729 3300005329 Bacteria 1314
4 Ga0070666_10204645 3300005335 Bacteria 1389
5 Ga0070687_100048281 3300005343 Bacteria 2188
6 Ga0070668_100205612 3300005347 Bacteria 1618
7 Ga0070671_100399328 3300005355 Bacteria 1176
8 Ga0070674_100437972 3300005356 Bacteria 1076
9 Ga0070714_100058447 3300005435 Bacteria 3303
10 Ga0070711_100015881 3300005439 Bacteria 4770
11 Ga0070711_100238510 3300005439 Bacteria 1421
12 Ga0070705_100058122 3300005440 Bacteria 2285
13 Ga0070663_100396530 3300005455 Bacteria 1127
14 Ga0070678_100018115 3300005456 Bacteria 4557
15 Ga0070681_10396648 3300005458 Bacteria 1291
16 Ga0068867_100112482 3300005459 Bacteria 2094
17 Ga0068867_100385045 3300005459 Bacteria 1179
18 Ga0070679_100090331 3300005530 Unclassified 3051
19 Ga0070696_100126202 3300005546 Bacteria 1857
20 Ga0070693_100091175 3300005547 Unclassified 1837
21 Ga0068854_100241059 3300005578 Bacteria 1440
22 Ga0068859_100167967 3300005617 Bacteria 2274
23 Ga0081538_10021916 3300005981 Bacteria 4646
24 Ga0081538_10025785 3300005981 Bacteria 4134
25 Ga0081540_1027599 3300005983 Bacteria 3211
26 Ga0081539_10006065 3300005985 Bacteria 11821
27 Ga0081539_10017242 3300005985 Bacteria 5084
28 Ga0070715_10199124 3300006163 Bacteria 1016
29 Ga0070712_100005578 3300006175 Bacteria 7784
30 Ga0070712_100451223 3300006175 Bacteria 1071
31 Ga0068871_100037316 3300006358 Bacteria 3874
32 Ga0068865_100074873 3300006881 Bacteria 2412
33 Ga0097620_100167967 3300006931 Bacteria 2274
34 Ga0105245_10475442 3300009098 Bacteria 1262
35 Ga0105247_10058433 3300009101 Bacteria 2386
36 Ga0105243_10010426 3300009148 Bacteria 7057
37 Ga0105243_10301774 3300009148 Bacteria 1452
38 Ga0105241_10048600 3300009174 Bacteria 3229
39 Ga0105242_10013347 3300009176 Bacteria 6346
40 Ga0105248_10096431 3300009177 Bacteria 3331
41 Ga0105239_10450775 3300010375 Bacteria 1460
42 Ga0157372_10114001 3300013307 Bacteria 3098
43 Ga0157375_11000675 3300013308 Bacteria 976
44 Ga0157379_10003193 3300014968 Bacteria 13886
45 Ga0157379_10005072 3300014968 Bacteria 11290
46 Ga0157376_10038619 3300014969 Bacteria 3886
47 Ga0207692_10054197 3300025898 Bacteria 2046
48 Ga0207710_10029198 3300025900 Bacteria 2398
49 Ga0207685_10164314 3300025905 Bacteria 1016
50 Ga0207654_10111973 3300025911 Bacteria 1700
51 Ga0207693_10002081 3300025915 Bacteria 17492
52 Ga0207693_10373788 3300025915 Bacteria 1115
53 Ga0207663_10174626 3300025916 Bacteria 1529
54 Ga0207660_10041529 3300025917 Bacteria 3223
55 Ga0207664_10048986 3300025929 Bacteria 3325
56 Ga0207644_10480768 3300025931 Bacteria 1023
57 Ga0207709_10069674 3300025935 Bacteria 2227
58 Ga0207704_10024125 3300025938 Bacteria 3292
59 Ga0207711_10049696 3300025941 Bacteria 3590
60 Ga0207677_10475420 3300026023 Bacteria 1076
61 Ga0207702_10333119 3300026078 Bacteria 1448
62 Ga0207641_10813293 3300026088 Bacteria 925
63 Ga0207648_10017014 3300026089 Bacteria 6626
64 Ga0207648_10057764 3300026089 Bacteria 3385
65 Ga0207675_100665089 3300026118 Unclassified 1048
66 Ga0207683_10000640 3300026121 Bacteria 32015
67 Ga0265338_10023929 3300028800 Bacteria 6259
68 Ga0265327_10003187 3300031251 Bacteria 16021
69 Ga0307408_100120492 3300031548 Bacteria 2032
70 Ga0307413_10209965 3300031824 Bacteria 1413
71 Ga0307406_10364143 3300031901 Bacteria 1134
72 Ga0307407_10013206 3300031903 Bacteria 3999
73 Ga0307411_10023115 3300032005 Bacteria 3675
74 Ga0373943_0052766 3300035170 Bacteria 2006
75 Ga0373937_0143415 3300036401 Bacteria 2235
76 Ga0395899_0025670 3300037312 Bacteria 4447
77 Ga0395899_0145649 3300037312 Bacteria 1682
78 Ga0395899_0230603 3300037312 Bacteria 1279
79 Ga0395900_0174980 3300037418 Bacteria 2183
80 Ga0395898_0198844 3300037466 Bacteria 1914
81 Ga0395898_0218139 3300037466 Bacteria 1820
82 Ga0395898_0283027 3300037466 Bacteria 1582
83 Ga0395898_0368642 3300037466 Bacteria 1369
84 Ga0395905_0017107 3300037471 Bacteria 6886
85 Ga0395905_0121329 3300037471 Bacteria 2457
86 Ga0395905_0224541 3300037471 Bacteria 1757
87 Ga0395901_0026964 3300038443 Bacteria 5899
88 Ga0395901_0159917 3300038443 Bacteria 2366
89 Ga0395901_0166406 3300038443 Bacteria 2315
90 Ga0395901_0372968 3300038443 Bacteria 1470
91 Ga0436365_0157247 3300039437 Bacteria 20207
92 Ga0466965_0158466 3300044683 Bacteria 1186
93 Ga0466961_0253019 3300044693 Bacteria 1081
94 Ga0466963_0066498 3300044694 Bacteria 2418
95 Ga0466963_0096351 3300044694 Bacteria 2021
96 Ga0466964_0026243 3300044706 Bacteria 2280
97 Ga0466971_0048721 3300044719 Bacteria 1905
98 Ga0466970_0184025 3300044765 Bacteria 1160
99 Ga0466970_0226339 3300044765 Bacteria 1044
100 Ga0466957_0180671 3300044842 Bacteria 1378
101 Ga0466960_0000037 3300044901 Bacteria 43394
102 Ga0466959_0064534 3300045049 Bacteria 2659
103 Ga0466959_0200148 3300045049 Bacteria 1391
104 Ga0466958_0182136 3300045836 Bacteria 1333
105 Ga0466967_0000002 3300045976 Bacteria 219994
106 Ga0466967_0002576 3300045976 Bacteria 11382
107 Ga0466967_0081067 3300045976 Bacteria 2930
108 Ga0466967_0222708 3300045976 Bacteria 1793
109 Ga0466967_0425847 3300045976 Bacteria 1294
110 Ga0466967_0453537 3300045976 Bacteria 1253
111 Ga0466967_0823854 3300045976 Bacteria 922
112 Ga0495603_0105948 3300046455 Bacteria 1641
113 Ga0495650_0000035 3300046471 Bacteria 403799
114 Ga0495588_0131926 3300046674 Bacteria 1318
115 Ga0495658_0116448 3300046683 Bacteria 1612
116 Ga0495624_0205978 3300046690 Unclassified 1194
117 Ga0495672_0021438 3300047320 Bacteria 4215
118 Ga0496100_0012431 3300048903 Bacteria 4880
119 Ga0496100_0123020 3300048903 Bacteria 1818
120 Ga0496100_0244227 3300048903 Bacteria 1326
121 Ga0496101_0032490 3300048904 Bacteria 3674
122 Ga0496101_0090478 3300048904 Bacteria 2276
123 Ga0496101_0218342 3300048904 Bacteria 1479
124 Ga0496102_0048030 3300048905 Bacteria 3880
125 Ga0496102_0166046 3300048905 Bacteria 2077
126 Ga0496103_0010835 3300048906 Bacteria 5396
127 Ga0496103_0182289 3300048906 Bacteria 1350
128 Ga0496104_0007627 3300048907 Bacteria 9581
129 Ga0496104_0049601 3300048907 Bacteria 3958
130 Ga0496105_0008271 3300048908 Bacteria 8090
131 Ga0496105_0071802 3300048908 Bacteria 2861
132 Ga0496106_0053307 3300048909 Bacteria 3054
133 Ga0496106_0172652 3300048909 Bacteria 1714
134 Ga0496107_0001480 3300048910 Bacteria 14533
135 Ga0496107_0015687 3300048910 Bacteria 5311
136 Ga0496108_0019593 3300048911 Bacteria 5557
137 Ga0496109_0000539 3300048912 Bacteria 32004
138 Ga0496109_0010909 3300048912 Bacteria 7783
139 Ga0496109_0099665 3300048912 Bacteria 2695
140 Ga0496110_0085583 3300048913 Bacteria 2813
141 Ga0496111_0198772 3300048914 Bacteria 1490
142 Ga0496112_0007231 3300048915 Bacteria 9840
143 Ga0496112_0032201 3300048915 Bacteria 5090
144 Ga0496112_0199460 3300048915 Bacteria 1961
145 Ga0496113_0089946 3300048916 Bacteria 2364
146 Ga0496114_0011880 3300048917 Bacteria 6969
147 Ga0496114_0332544 3300048917 Bacteria 1343
148 Ga0496117_0037620 3300048920 Bacteria 3603
149 Ga0496119_0131220 3300048922 Bacteria 1365
150 Ga0496121_0064634 3300048924 Bacteria 2982
151 Ga0496124_0289047 3300048927 Bacteria 1191
152 Ga0496126_0078878 3300048929 Bacteria 2917
153 Ga0501034_0005460 3300049571 Bacteria 13884
154 Ga0501034_0607424 3300049571 Bacteria 999
155 Ga0501043_0023737 3300049579 Bacteria 4810
156 Ga0501046_0540502 3300049580 Bacteria 831
157 Ga0501047_0263569 3300049581 Bacteria 1570
158 Ga0501080_0010205 3300049742 Bacteria 8588
159 Ga0501044_0200833 3300049823 Bacteria 1952
160 Ga0495655_0030289 3300053083 Bacteria 1308
161 Ga0500556_0000750 3300053104 Bacteria 19347
162 Ga0500616_0006968 3300053153 Bacteria 7278
163 Ga0500616_0013239 3300053153 Bacteria 4798
164 Ga0501084_0079139 3300054114 Bacteria 2755
165 2857730708 2857729791 Bacteria 4040535
166 Ga0501042_0146876
167 Ga0070683_100230026
168 Ga0070683_100397729
169 Ga0070666_10204645
170 Ga0070687_100048281
171 Ga0070668_100205612
172 Ga0070671_100399328
173 Ga0070674_100437972
174 Ga0070714_100058447
175 Ga0070711_100015881
176 Ga0070711_100238510
177 Ga0070705_100058122
178 Ga0070663_100396530
179 Ga0070678_100018115
180 Ga0070681_10396648
181 Ga0068867_100112482
182 Ga0068867_100385045
183 Ga0070679_100090331
184 Ga0070696_100126202
185 Ga0070693_100091175
186 Ga0068854_100241059
187 Ga0068859_100167967
188 Ga0081538_10021916
189 Ga0081538_10025785
190 Ga0081540_1027599
191 Ga0081539_10006065
192 Ga0081539_10017242
193 Ga0070715_10199124
194 Ga0070712_100005578
195 Ga0070712_100451223
196 Ga0068871_100037316
197 Ga0068865_100074873
198 Ga0097620_100167967
199 Ga0105245_10475442
200 Ga0105247_10058433
201 Ga0105243_10010426
202 Ga0105243_10301774
203 Ga0105241_10048600
204 Ga0105242_10013347
205 Ga0105248_10096431
206 Ga0105239_10450775
207 Ga0157372_10114001
208 Ga0157375_11000675
209 Ga0157379_10003193
210 Ga0157379_10005072
211 Ga0157376_10038619
212 Ga0207692_10054197
213 Ga0207710_10029198
214 Ga0207685_10164314
215 Ga0207654_10111973
216 Ga0207693_10002081
217 Ga0207693_10373788
218 Ga0207663_10174626
219 Ga0207660_10041529
220 Ga0207664_10048986
221 Ga0207644_10480768
222 Ga0207709_10069674
223 Ga0207704_10024125
224 Ga0207711_10049696
225 Ga0207677_10475420
226 Ga0207702_10333119
227 Ga0207641_10813293
228 Ga0207648_10017014
229 Ga0207648_10057764
230 Ga0207675_100665089
231 Ga0207683_10000640
232 Ga0265338_10023929
233 Ga0265327_10003187
234 Ga0307408_100120492
235 Ga0307413_10209965
236 Ga0307406_10364143
237 Ga0307407_10013206
238 Ga0307411_10023115
239 Ga0373943_0052766
240 Ga0373937_0143415
241 Ga0395899_0025670
242 Ga0395899_0145649
243 Ga0395899_0230603
244 Ga0395900_0174980
245 Ga0395898_0198844
246 Ga0395898_0218139
247 Ga0395898_0283027
248 Ga0395898_0368642
249 Ga0395905_0017107
250 Ga0395905_0121329
251 Ga0395905_0224541
252 Ga0395901_0026964
253 Ga0395901_0159917
254 Ga0395901_0166406
255 Ga0395901_0372968
256 Ga0436365_0157247
257 Ga0466965_0158466
258 Ga0466961_0253019
259 Ga0466963_0066498
260 Ga0466963_0096351
261 Ga0466964_0026243
262 Ga0466971_0048721
263 Ga0466970_0184025
264 Ga0466970_0226339
265 Ga0466957_0180671
266 Ga0466960_0000037
267 Ga0466959_0064534
268 Ga0466959_0200148
269 Ga0466958_0182136
270 Ga0466967_0000002
271 Ga0466967_0002576
272 Ga0466967_0081067
273 Ga0466967_0222708
274 Ga0466967_0425847
275 Ga0466967_0453537
276 Ga0466967_0823854
277 Ga0495603_0105948
278 Ga0495650_0000035
279 Ga0495588_0131926
280 Ga0495658_0116448
281 Ga0495624_0205978
282 Ga0495672_0021438
283 Ga0496100_0012431
284 Ga0496100_0123020
285 Ga0496100_0244227
286 Ga0496101_0032490
287 Ga0496101_0090478
288 Ga0496101_0218342
289 Ga0496102_0048030
290 Ga0496102_0166046
291 Ga0496103_0010835
292 Ga0496103_0182289
293 Ga0496104_0007627
294 Ga0496104_0049601
295 Ga0496105_0008271
296 Ga0496105_0071802
297 Ga0496106_0053307
298 Ga0496106_0172652
299 Ga0496107_0001480
300 Ga0496107_0015687
301 Ga0496108_0019593
302 Ga0496109_0000539
303 Ga0496109_0010909
304 Ga0496109_0099665
305 Ga0496110_0085583
306 Ga0496111_0198772
307 Ga0496112_0007231
308 Ga0496112_0032201
309 Ga0496112_0199460
310 Ga0496113_0089946
311 Ga0496114_0011880
312 Ga0496114_0332544
313 Ga0496117_0037620
314 Ga0496119_0131220
315 Ga0496121_0064634
316 Ga0496124_0289047
317 Ga0496126_0078878
318 Ga0501034_0005460
319 Ga0501034_0607424
320 Ga0501043_0023737
321 Ga0501046_0540502
322 Ga0501047_0263569
323 Ga0501080_0010205
324 Ga0501044_0200833
325 Ga0495655_0030289
326 Ga0500556_0000750
327 Ga0500616_0006968
328 Ga0500616_0013239
329 Ga0501084_0079139
330 2857730708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04454

Linocin_M18

Encapsulating protein for peroxidase

21

273

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i9g-assembly1.cif.gz_A crystal structure of encapsulin from mycolicibacterium hassiacum 0.8712 1 266
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8696 1 266
8ika-assembly1.cif.gz_A1 cryo-em structure of the encapsulin shell from mycobacterium tuberculosis 0.8683 1 266
6i9g-assembly1.cif.gz_A crystal structure of encapsulin from mycolicibacterium hassiacum 0.8649 1 266
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8633 1 266
ID Description Score Start End Superfamily
3dktA02 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;hypothetical protein PF0899 domain 0.8085 143 220 3.30.2320.10
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7772 1 256 3.30.2400.30
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7729 1 256 3.30.2400.30
2e0zC01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7367 16 252 3.30.2400.20
2e0zC01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.6936 16 252 3.30.2400.20
ID Description Score Start End GO Terms
AF-A0A6P4G5J1-F1-model_v4 deleted 0.9515 129 265
AF-A0A2K4P227-F1-model_v4 deleted 0.948 96 267
AF-A0A2S8MKP2-F1-model_v4 deleted 0.9385 162 266
AF-A0A6P4G5J1-F1-model_v4 deleted 0.9382 129 265
AF-W5WIE0-F1-model_v4 Bacteriocin 0.9343 154 265 GO:0140737

Map