F247328

General Info

Members Datasets Scaffolds Average Seq Length
165 113 120 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939626828|2939628642
Length 232
Sequence LLLKPSSSRLPLDYPAPPRFDLGPMRVFLLVLSLLVPALWPCSVAALEVQEGDLLFVTAGHGGLSAAIDDATGKQGAPSFDHVALVASAPQGWEVLHADEKGSRRQTLEHFREDARGKQRQIVVYRLRAPPDNAIADAVATARTMLGKPYNTAYVLNDDSYYCSDFIERAFRALHVFALQPMNFRNPQTGEISRHWVDLYRGMGMEVPQGLPGTNPNDMAATPVLQRIGVLE

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
9 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
15 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
16 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
17 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
18 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
19 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
20 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
25 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
26 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
27 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
28 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
29 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
30 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
31 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
32 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
33 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
34 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
35 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
36 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
37 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
38 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
39 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
40 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
41 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
42 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
43 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
44 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
45 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
88 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.73
Metatranscriptomes 0
Isolates 27.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 1.21
Rhizoplane 1.21
Rhizosphere 59.39
Stem 0
Stem Tuber 0
Unclassified 33.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002935 3300001915 Bacteria 4256
2 rootH2_10008473 3300003320 Bacteria 47100
3 rootH1_10065677 3300003323 Bacteria 1579
4 Ga0055536_1002227 3300003781 Bacteria 11037
5 Ga0055534_1012764 3300003784 Bacteria 1645
6 Ga0058692_1000004 3300003856 Bacteria 431119
7 Ga0065714_10066326 3300005288 Bacteria 7098
8 Ga0065704_10130335 3300005289 Bacteria 1636
9 Ga0065704_10135091 3300005289 Bacteria 1550
10 Ga0070682_100000561 3300005337 Bacteria 22887
11 Ga0070660_100161054 3300005339 Bacteria 1808
12 Ga0070668_100000333 3300005347 Bacteria 31087
13 Ga0070668_100500015 3300005347 Bacteria 1052
14 Ga0070663_100192195 3300005455 Bacteria 1589
15 Ga0070678_100253574 3300005456 Bacteria 1476
16 Ga0070665_100021102 3300005548 Bacteria 6548
17 Ga0068854_100206137 3300005578 Bacteria 1548
18 Ga0075364_10002157 3300006051 Bacteria 11031
19 Ga0075362_10035347 3300006177 Bacteria 2181
20 Ga0105244_10000001 3300009036 Bacteria 1034899
21 Ga0105244_10015424 3300009036 Bacteria 4383
22 Ga0105243_10000603 3300009148 Bacteria 35815
23 Ga0105243_10029364 3300009148 Bacteria 4227
24 Ga0105243_10262928 3300009148 Bacteria 1546
25 Ga0157373_10032269 3300013100 Bacteria 3770
26 Ga0157373_10073144 3300013100 Bacteria 2419
27 Ga0157373_10108791 3300013100 Bacteria 1949
28 Ga0157371_10011302 3300013102 Bacteria 6891
29 Ga0157371_10048253 3300013102 Bacteria 3027
30 Ga0157371_10095903 3300013102 Bacteria 2102
31 Ga0157370_10009087 3300013104 Bacteria 10660
32 Ga0157370_10022213 3300013104 Bacteria 6313
33 Ga0157370_10031741 3300013104 Bacteria 5164
34 Ga0157370_10654842 3300013104 Bacteria 960
35 Ga0157369_10003002 3300013105 Bacteria 20184
36 Ga0157369_10254183 3300013105 Bacteria 1834
37 Ga0157369_10849143 3300013105 Bacteria 937
38 Ga0182008_10000016 3300014497 Bacteria 241246
39 Ga0182008_10200965 3300014497 Bacteria 1014
40 Ga0182006_1000003 3300015261 Bacteria 826681
41 Ga0182006_1007689 3300015261 Bacteria 4923
42 Ga0182007_10043183 3300015262 Bacteria 1499
43 Ga0163161_10002859 3300017792 Bacteria 12239
44 Ga0163161_10003832 3300017792 Bacteria 10544
45 Ga0209675_1000077 3300025291 Bacteria 156212
46 Ga0209676_1000190 3300025292 Bacteria 140482
47 Ga0209257_1000179 3300025304 Bacteria 158484
48 Ga0207655_1000018 3300025728 Bacteria 537129
49 Ga0207657_10099832 3300025919 Bacteria 2410
50 Ga0207709_10000161 3300025935 Bacteria 91314
51 Ga0207709_10008044 3300025935 Bacteria 5841
52 Ga0207668_10008092 3300025972 Bacteria 6260
53 Ga0207683_10288191 3300026121 Bacteria 1501
54 Ga0209371_1000018 3300027312 Bacteria 614700
55 Ga0209371_1035928 3300027312 Bacteria 1040
56 Ga0268266_10014472 3300028379 Bacteria 6781
57 Ga0268256_1000016 3300030500 Bacteria 614700
58 Ga0268256_1040841 3300030500 Bacteria 1040
59 Ga0307412_10001568 3300031911 Bacteria 12584
60 Ga0307412_10003894 3300031911 Bacteria 8309
61 Ga0307416_100000013 3300032002 Bacteria 283585
62 Ga0307414_10005317 3300032004 Bacteria 7080
63 Ga0307411_10846604 3300032005 Bacteria 809
64 Ga0450911_000492 3300042115 Bacteria 12576
65 Ga0450901_005766 3300042533 Bacteria 1272
66 Ga0495627_017597 3300046453 Bacteria 2426
67 Ga0495605_0184163 3300046474 Bacteria 917
68 Ga0495596_0000866 3300046500 Bacteria 18212
69 Ga0495606_0020380 3300046507 Bacteria 4890
70 Ga0495606_0028755 3300046507 Bacteria 3914
71 Ga0495606_0031006 3300046507 Bacteria 3723
72 Ga0495610_0000006 3300046512 Bacteria 856822
73 Ga0495610_0109957 3300046512 Bacteria 1222
74 Ga0495616_0025726 3300046513 Bacteria 3140
75 Ga0495643_0047821 3300046522 Bacteria 2315
76 Ga0495663_0000287 3300046525 Bacteria 19275
77 Ga0495663_0000937 3300046525 Bacteria 9730
78 Ga0495663_0001389 3300046525 Bacteria 7639
79 Ga0495663_0011540 3300046525 Bacteria 2457
80 Ga0495633_0000597 3300046558 Bacteria 34839
81 Ga0495660_0074721 3300046810 Bacteria 1790
82 Ga0496103_0036145 3300048906 Bacteria 3025
83 Ga0496113_0021288 3300048916 Bacteria 4572
84 Ga0496116_0000052 3300048919 Bacteria 295469
85 Ga0496116_0001837 3300048919 Bacteria 22940
86 Ga0496116_0042656 3300048919 Bacteria 3098
87 Ga0496117_0000027 3300048920 Bacteria 412234
88 Ga0496117_0127088 3300048920 Bacteria 1553
89 Ga0496118_0000375 3300048921 Bacteria 75195
90 Ga0496118_0008988 3300048921 Bacteria 10191
91 Ga0496118_0176280 3300048921 Bacteria 1298
92 Ga0496119_0000006 3300048922 Bacteria 505999
93 Ga0496119_0006783 3300048922 Bacteria 10497
94 Ga0496119_0155063 3300048922 Bacteria 1223
95 Ga0496120_0033969 3300048923 Bacteria 3059
96 Ga0496121_0006948 3300048924 Bacteria 13783
97 Ga0496121_0142734 3300048924 Bacteria 1774
98 Ga0496122_0000229 3300048925 Bacteria 125600
99 Ga0496122_0000397 3300048925 Bacteria 92511
100 Ga0496122_0002363 3300048925 Bacteria 27111
101 Ga0496122_0002472 3300048925 Bacteria 26127
102 Ga0496122_0003907 3300048925 Bacteria 19078
103 Ga0496122_0092616 3300048925 Bacteria 2053
104 Ga0496123_0001467 3300048926 Bacteria 32731
105 Ga0496123_0010259 3300048926 Bacteria 8309
106 Ga0496123_0026701 3300048926 Bacteria 4318
107 Ga0496123_0037890 3300048926 Bacteria 3398
108 Ga0496124_0000006 3300048927 Bacteria 904259
109 Ga0496124_0001244 3300048927 Bacteria 39137
110 Ga0496124_0023397 3300048927 Bacteria 5639
111 Ga0496125_0001071 3300048928 Bacteria 42210
112 Ga0496125_0007285 3300048928 Bacteria 11779
113 Ga0496125_0029847 3300048928 Bacteria 4891
114 Ga0496126_0002697 3300048929 Bacteria 23467
115 Ga0496126_0027998 3300048929 Bacteria 5374
116 Ga0496126_0046594 3300048929 Bacteria 3975
117 Ga0496126_0126075 3300048929 Bacteria 2216
118 Ga0496126_0616056 3300048929 Bacteria 853
119 Ga0501241_000003 3300049758 Bacteria 178857
120 nmdc:mga00v17_37_c2 3300050491 Bacteria 69797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100021102 Ga0070665_1000211023 193
2 3300005578 Ga0068854_100206137 Ga0068854_1002061371 193
3 3300014497 Ga0182008_10200965 Ga0182008_102009651 193
4 3300017792 Ga0163161_10003832 Ga0163161_1000383210 193
5 3300028379 Ga0268266_10014472 Ga0268266_100144725 193
6 3300031911 Ga0307412_10001568 Ga0307412_100015685 193
7 3300032004 Ga0307414_10005317 Ga0307414_100053176 193
8 3300042115 Ga0450911_000492 Ga0450911_000492_8550_9185 193
9 3300046522 Ga0495643_0047821 Ga0495643_0047821_1250_1903 193
10 3300048916 Ga0496113_0021288 Ga0496113_0021288_49_675 193
11 3300048925 Ga0496122_0092616 Ga0496122_0092616_674_1300 193
12 3300048926 Ga0496123_0026701 Ga0496123_0026701_673_1299 193
13 3300048927 Ga0496124_0023397 Ga0496124_0023397_3251_3877 193
14 3300048928 Ga0496125_0007285 Ga0496125_0007285_7763_8389 193
15 3300048929 Ga0496126_0616056 Ga0496126_0616056_179_805 193
16 iso_pu_bacteria 2747842501 2748018717 201
17 iso_pu_bacteria 2842780639 2842782857 202
18 3300048925 Ga0496122_0002472 Ga0496122_0002472_12079_12696 203
19 3300048926 Ga0496123_0010259 Ga0496123_0010259_4542_5159 203
20 3300048929 Ga0496126_0046594 Ga0496126_0046594_1399_2016 203
21 iso_pu_bacteria 2547132130 2547499494 203
22 iso_pu_bacteria 2547132130 2547500259 203
23 iso_pu_bacteria 2747842428 2747947381 203
24 iso_pu_bacteria 2765235840 2765580928 203
25 iso_pu_bacteria 2816332141 2816518075 203
26 iso_pu_bacteria 2842391507 2842394546 203
27 iso_pu_bacteria 2842757796 2842759432 203
28 iso_pu_bacteria 2874220319 2874223590 203
29 iso_pu_bacteria 2919089067 2919089145 203
30 iso_pu_bacteria 2919134579 2919136615 203
31 iso_pu_bacteria 2928496128 2928497022 203
32 iso_pu_bacteria 2931380184 2931383004 203
33 iso_pu_bacteria 2937610967 2937613929 203
34 iso_pu_bacteria 2961047084 2961050354 203
35 iso_pu_bacteria 2961064222 2961064511 203
36 iso_pu_bacteria 2585428045 2587679450 204
37 iso_pu_bacteria 2588254255 2590601636 204
38 3300006177 Ga0075362_10035347 Ga0075362_100353472 205
39 3300013104 Ga0157370_10009087 Ga0157370_100090877 205
40 3300013105 Ga0157369_10003002 Ga0157369_1000300216 205
41 3300046474 Ga0495605_0184163 Ga0495605_0184163_117_740 205
42 3300046507 Ga0495606_0031006 Ga0495606_0031006_2903_3526 205
43 3300046512 Ga0495610_0109957 Ga0495610_0109957_225_848 205
44 3300046513 Ga0495616_0025726 Ga0495616_0025726_1300_1923 205
45 3300046810 Ga0495660_0074721 Ga0495660_0074721_769_1392 205
46 3300048927 Ga0496124_0000006 Ga0496124_0000006_38557_39180 205
47 iso_pu_bacteria 2585428182 2588210377 205
48 iso_pu_bacteria 2816332188 2816874530 205
49 iso_pu_bacteria 2889290771 2889295175 205
50 3300003320 rootH2_10008473 rootH2_100084735 206
51 3300003323 rootH1_10065677 rootH1_100656772 206
52 3300003781 Ga0055536_1002227 Ga0055536_10022278 206
53 3300005289 Ga0065704_10130335 Ga0065704_101303353 206
54 3300005289 Ga0065704_10135091 Ga0065704_101350913 206
55 3300005347 Ga0070668_100000333 Ga0070668_10000033316 206
56 3300005456 Ga0070678_100253574 Ga0070678_1002535741 206
57 3300009036 Ga0105244_10015424 Ga0105244_100154243 206
58 3300009148 Ga0105243_10029364 Ga0105243_100293643 206
59 3300013100 Ga0157373_10032269 Ga0157373_100322694 206
60 3300013100 Ga0157373_10073144 Ga0157373_100731443 206
61 3300013100 Ga0157373_10108791 Ga0157373_101087913 206
62 3300013102 Ga0157371_10011302 Ga0157371_100113025 206
63 3300013102 Ga0157371_10048253 Ga0157371_100482533 206
64 3300013104 Ga0157370_10031741 Ga0157370_100317415 206
65 3300013105 Ga0157369_10254183 Ga0157369_102541832 206
66 3300015261 Ga0182006_1007689 Ga0182006_10076893 206
67 3300025292 Ga0209676_1000190 Ga0209676_100019015 206
68 3300025935 Ga0207709_10008044 Ga0207709_100080443 206
69 3300025972 Ga0207668_10008092 Ga0207668_100080923 206
70 3300026121 Ga0207683_10288191 Ga0207683_102881912 206
71 3300027312 Ga0209371_1035928 Ga0209371_10359281 206
72 3300030500 Ga0268256_1040841 Ga0268256_10408412 206
73 3300032005 Ga0307411_10846604 Ga0307411_108466041 206
74 3300042533 Ga0450901_005766 Ga0450901_005766_457_1083 206
75 3300046525 Ga0495663_0000937 Ga0495663_0000937_7914_8540 206
76 3300046525 Ga0495663_0001389 Ga0495663_0001389_3677_4303 206
77 3300046558 Ga0495633_0000597 Ga0495633_0000597_18949_19575 206
78 3300048919 Ga0496116_0001837 Ga0496116_0001837_13617_14252 206
79 3300048919 Ga0496116_0042656 Ga0496116_0042656_2462_3088 206
80 3300048920 Ga0496117_0127088 Ga0496117_0127088_614_1240 206
81 3300048921 Ga0496118_0008988 Ga0496118_0008988_7486_8112 206
82 3300048921 Ga0496118_0176280 Ga0496118_0176280_397_1023 206
83 3300048922 Ga0496119_0006783 Ga0496119_0006783_2396_3019 206
84 3300048922 Ga0496119_0155063 Ga0496119_0155063_570_1196 206
85 3300048923 Ga0496120_0033969 Ga0496120_0033969_1900_2526 206
86 3300048924 Ga0496121_0006948 Ga0496121_0006948_5214_5840 206
87 3300048929 Ga0496126_0027998 Ga0496126_0027998_4133_4759 206
88 iso_pu_bacteria 2871720351 2871724184 206
89 3300025935 Ga0207709_10000161 Ga0207709_1000016131 208
90 3300003784 Ga0055534_1012764 Ga0055534_10127642 209
91 3300025291 Ga0209675_1000077 Ga0209675_100007782 209
92 3300003856 Ga0058692_1000004 Ga0058692_1000004217 210
93 3300027312 Ga0209371_1000018 Ga0209371_1000018179 210
94 3300030500 Ga0268256_1000016 Ga0268256_1000016179 210
95 3300006051 Ga0075364_10002157 Ga0075364_100021572 211
96 3300050491 nmdc:mga00v17_37_c2 nmdc:mga00v17_37_c2_12293_12934 211
97 iso_pu_bacteria 2585428095 2587867119 211
98 iso_pu_bacteria 2739367874 2740059153 211
99 iso_pu_bacteria 2751185877 2753673207 211
100 iso_pu_bacteria 2977243572 2977244868 212
101 iso_pu_bacteria 2919399522 2919402140 213
102 3300005288 Ga0065714_10066326 Ga0065714_100663261 214
103 3300025304 Ga0209257_1000179 Ga0209257_1000179132 214
104 iso_pu_bacteria 2772190705 2772604890 214
105 3300013104 Ga0157370_10654842 Ga0157370_106548422 215
106 3300013105 Ga0157369_10849143 Ga0157369_108491432 215
107 3300017792 Ga0163161_10002859 Ga0163161_100028597 215
108 3300031911 Ga0307412_10003894 Ga0307412_100038945 215
109 3300046453 Ga0495627_017597 Ga0495627_017597_627_1283 215
110 3300046507 Ga0495606_0020380 Ga0495606_0020380_1155_1808 215
111 3300046507 Ga0495606_0028755 Ga0495606_0028755_2498_3148 215
112 3300046525 Ga0495663_0000287 Ga0495663_0000287_18455_19108 215
113 3300046525 Ga0495663_0011540 Ga0495663_0011540_285_935 215
114 3300049758 Ga0501241_000003 Ga0501241_000003_114915_115574 215
115 iso_pu_bacteria 2511231000 2511232277 217
116 iso_pu_bacteria 2582581281 2585158403 217
117 iso_pu_bacteria 2582581282 2585162614 217
118 iso_pu_bacteria 2585428061 2587753366 217
119 3300009148 Ga0105243_10000603 Ga0105243_1000060311 218
120 3300048925 Ga0496122_0000229 Ga0496122_0000229_27193_27849 218
121 3300048925 Ga0496122_0000397 Ga0496122_0000397_32549_33208 218
122 iso_pu_bacteria 2585428183 2588214378 218
123 iso_pu_bacteria 2585428184 2588217559 218
124 iso_pu_bacteria 2939626828 2939628642 218
125 iso_pu_bacteria 2585428060 2587746284 219
126 iso_pu_bacteria 2588253712 2588443950 219
127 iso_pu_bacteria 2588254257 2590613655 219
128 iso_pu_bacteria 2842083920 2842088112 219
129 iso_pu_bacteria 2905999023 2906002048 219
130 iso_pu_bacteria 2946019816 2946022776 219
131 3300048929 Ga0496126_0002697 Ga0496126_0002697_19031_19693 220
132 iso_pu_bacteria 2582581278 2585143789 220
133 iso_pu_bacteria 2585428185 2588223175 220
134 iso_pu_bacteria 2765235839 2765574310 220
135 3300005347 Ga0070668_100500015 Ga0070668_1005000151 221
136 3300014497 Ga0182008_10000016 Ga0182008_10000016109 221
137 3300005337 Ga0070682_100000561 Ga0070682_1000005615 222
138 3300005339 Ga0070660_100161054 Ga0070660_1001610542 222
139 3300005455 Ga0070663_100192195 Ga0070663_1001921951 222
140 3300009148 Ga0105243_10262928 Ga0105243_102629282 222
141 3300013102 Ga0157371_10095903 Ga0157371_100959032 222
142 3300025919 Ga0207657_10099832 Ga0207657_100998323 222
143 3300048906 Ga0496103_0036145 Ga0496103_0036145_465_1133 222
144 3300048919 Ga0496116_0000052 Ga0496116_0000052_22597_23265 222
145 3300048920 Ga0496117_0000027 Ga0496117_0000027_377990_378658 222
146 3300048921 Ga0496118_0000375 Ga0496118_0000375_60938_61606 222
147 3300048922 Ga0496119_0000006 Ga0496119_0000006_211436_212104 222
148 3300048924 Ga0496121_0142734 Ga0496121_0142734_341_1009 222
149 3300048925 Ga0496122_0002363 Ga0496122_0002363_22268_22936 222
150 3300048926 Ga0496123_0001467 Ga0496123_0001467_8003_8671 222
151 3300048927 Ga0496124_0001244 Ga0496124_0001244_21206_21874 222
152 3300048928 Ga0496125_0029847 Ga0496125_0029847_1771_2439 222
153 3300015261 Ga0182006_1000003 Ga0182006_1000003422 223
154 3300015262 Ga0182007_10043183 Ga0182007_100431833 223
155 3300032002 Ga0307416_100000013 Ga0307416_100000013257 223
156 3300046512 Ga0495610_0000006 Ga0495610_0000006_423120_423791 223
157 3300001915 JGI24741J21665_1002935 JGI24741J21665_10029353 224
158 3300009036 Ga0105244_10000001 Ga0105244_10000001482 224
159 3300013104 Ga0157370_10022213 Ga0157370_100222136 224
160 3300025728 Ga0207655_1000018 Ga0207655_100001812 224
161 3300046500 Ga0495596_0000866 Ga0495596_0000866_1673_2347 224
162 3300048925 Ga0496122_0003907 Ga0496122_0003907_14732_15406 224
163 3300048926 Ga0496123_0037890 Ga0496123_0037890_2413_3087 224
164 3300048928 Ga0496125_0001071 Ga0496125_0001071_2454_3128 224
165 3300048929 Ga0496126_0126075 Ga0496126_0126075_872_1546 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05708

Peptidase_C92

Permuted papain-like amidase enzyme, YaeF/YiiX, C92 family

48

229

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2if6-assembly2.cif.gz_B crystal structure of metalloprotein yiix from escherichia coli o157:h7, duf1105 0.7964 40 224
2if6-assembly2.cif.gz_B crystal structure of metalloprotein yiix from escherichia coli o157:h7, duf1105 0.7803 40 224
3kw0-assembly1.cif.gz_D crystal structure of cysteine peptidase (np_982244.1) from bacillus cereus atcc 10987 at 2.50 a resolution 0.7232 41 223
2im9-assembly1.cif.gz_A crystal structure of protein lpg0564 from legionella pneumophila str. philadelphia 1, pfam duf1460 0.7166 40 110
3kw0-assembly1.cif.gz_C crystal structure of cysteine peptidase (np_982244.1) from bacillus cereus atcc 10987 at 2.50 a resolution 0.7151 41 224
ID Description Score Start End Superfamily
2if6A00 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.8168 40 224 3.90.1720.10
af_Q20352_1_188_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.8015 40 224 3.90.1720.10
2if6A00 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7924 40 224 3.90.1720.10
af_Q20352_1_188_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7863 40 224 3.90.1720.10
af_P24238_8_188_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7742 40 224 3.90.1720.10
ID Description Score Start End GO Terms
AF-A0A0Q5QIE9-F1-model_v4 Peptidoglycan peptidase 0.99 48 224
AF-A0A1E7R9W3-F1-model_v4 YiiX family permuted papain-like enzyme 0.9898 39 224
AF-A0A3C2CBP0-F1-model_v4 deleted 0.9898 119 224
AF-A0A1Q3Z9Q7-F1-model_v4 deleted 0.9888 40 224
AF-A0A6P1QSU7-F1-model_v4 Uncharacterized protein 0.9878 41 224

Feature Viewer

pLDDT pTM Quality
87.6 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map