F247482

General Info

Members Datasets Scaffolds Average Seq Length
166 114 333 337

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10003685|rootL2_100036857
Length 364
Sequence LRGSRLKVIWQVTSRIYITFKRKKVDKVIVIAEAGVNHNGSIDLAKQLIDAAAEAGADYVKFQTFKADKLVSTVAKKAAYQAKNLNDGDDSQYTMLKNLELSEQNHIVLKAYAAEKQIRFLSTGFDEESIDFLNSLGMDFFKVPSGEITNYPYLKHIASKKKPVVVSTGMATLGEIEAALTLLIEAGVSSGNITVLHCTTQYPTPYEDVNLKAMQTIANAFKVKVGYSDHTIGIEVPIAAVALGATIIEKHFTMDRSLPGPDHKASLEPDELKAMVTGIRNIELAISGDGIKRPSKTELENKVVARKSIHLKRDIMKGDTILSDDLIMMRPSDGISPTMIEMVIGKKVNKNLESGSKLSFSDFS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
91 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
92 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
93 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
95 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
96 2718217882 Rhizobium sp. N741 Isolate Nodule
97 2718218009 Rhizobium sp. N561 Isolate Nodule
98 2718218363 Rhizobium sp. N113 Isolate Nodule
99 2718218365 Rhizobium sp. N731 Isolate Nodule
100 2718218366 Rhizobium sp. N621 Isolate Nodule
101 2721755514 Rhizobium sp. N6212 Isolate Nodule
102 2721755810 Rhizobium sp. N871 Isolate Nodule
103 2728369365 Rhizobium sp. N1341 Isolate Nodule
104 2728369397 Rhizobium sp. N1314 Isolate Nodule
105 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
106 2791355264 Rhizobium sp. S9 Isolate Nodule
107 2791355266 Rhizobium sp. L43 Isolate Nodule
108 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
109 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
110 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
111 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
112 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
113 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
114 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.95
Metatranscriptomes 0
Isolates 12.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.45
Nodule 8.43
Rhizoplane 0
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10003685 3300003322 Bacteria 8388
2 JGI24740J21852_10006356 3300001979 Bacteria 4901
3 JGI25153J46596_10000062 3300003215 Bacteria 129749
4 JGI25153J46596_10000781 3300003215 Bacteria 19494
5 JGI25153J46596_10007646 3300003215 Bacteria 5274
6 rootH2_10019643 3300003320 Bacteria 21373
7 rootH2_10202053 3300003320 Bacteria 3804
8 rootL2_10131310 3300003322 Unclassified 3183
9 rootH1_10003366 3300003316 Bacteria 5707
10 rootH1_10003366 3300003323 Bacteria 132108
11 rootH1_10004759 3300003323 Bacteria 40082
12 rootH1_10011717 3300003323 Bacteria 17344
13 rootH1_10011718 3300003323 Bacteria 12705
14 rootH1_10258632 3300003323 Bacteria 4900
15 JGI25160J50197_1005101 3300003354 Bacteria 5530
16 Ga0065165_1022402 3300005262 Bacteria 2167
17 Ga0070658_10000596 3300005327 Bacteria 31295
18 Ga0070682_100043550 3300005337 Bacteria 2776
19 Ga0070687_100043451 3300005343 Unclassified 2284
20 Ga0070675_100347971 3300005354 Bacteria 1314
21 Ga0070671_100009954 3300005355 Bacteria 7636
22 Ga0070674_100035752 3300005356 Unclassified 3329
23 Ga0070674_100107906 3300005356 Unclassified 2039
24 Ga0070673_100028054 3300005364 Bacteria 4181
25 Ga0070673_100191455 3300005364 Unclassified 1757
26 Ga0070703_10001632 3300005406 Bacteria 6661
27 Ga0070701_10159933 3300005438 Unclassified 1304
28 Ga0070700_100029629 3300005441 Unclassified 3265
29 Ga0070708_100007003 3300005445 Bacteria 8995
30 Ga0070681_10008107 3300005458 Bacteria 10278
31 Ga0070681_10066777 3300005458 Bacteria 3566
32 Ga0068867_100055765 3300005459 Bacteria 2922
33 Ga0070706_100002860 3300005467 Bacteria 17205
34 Ga0070707_100021543 3300005468 Bacteria 6094
35 Ga0070698_100054758 3300005471 Bacteria 4049
36 Ga0070699_100002010 3300005518 Bacteria 18363
37 Ga0070697_100005273 3300005536 Bacteria 9923
38 Ga0070686_100018111 3300005544 Bacteria 4128
39 Ga0070665_100001783 3300005548 Bacteria 24521
40 Ga0068855_100001663 3300005563 Bacteria 27798
41 Ga0068855_100075064 3300005563 Bacteria 3926
42 Ga0068855_100278270 3300005563 Bacteria 1859
43 Ga0068861_100297541 3300005719 Unclassified 1396
44 Ga0075366_10016102 3300006195 Bacteria 4293
45 Ga0105240_10000198 3300009093 Bacteria 122388
46 Ga0105240_10013476 3300009093 Archaea 11230
47 Ga0105240_10144173 3300009093 Bacteria 2844
48 Ga0105240_10229148 3300009093 Bacteria 2160
49 Ga0105241_10000137 3300009174 Bacteria 52153
50 Ga0105237_10000781 3300009545 Bacteria 43601
51 Ga0105237_10003050 3300009545 Bacteria 20205
52 Ga0105237_10006169 3300009545 Bacteria 13388
53 Ga0105238_10006856 3300009551 Bacteria 11374
54 Ga0105238_10172398 3300009551 Bacteria 2140
55 Ga0105239_10000298 3300010375 Bacteria 73328
56 Ga0105239_10001227 3300010375 Bacteria 34941
57 Ga0105239_10005875 3300010375 Bacteria 14303
58 Ga0105239_10008489 3300010375 Bacteria 11680
59 Ga0157371_10121358 3300013102 Bacteria 1858
60 Ga0157370_10000485 3300013104 Bacteria 49509
61 Ga0157370_10001243 3300013104 Bacteria 31845
62 Ga0157370_10002152 3300013104 Bacteria 24067
63 Ga0157374_10011375 3300013296 Bacteria 7703
64 Ga0157378_10005467 3300013297 Bacteria 11130
65 Ga0157378_10032839 3300013297 Bacteria 4588
66 Ga0157372_10033145 3300013307 Bacteria 5671
67 Ga0157372_10039763 3300013307 Bacteria 5192
68 Ga0157375_10509638 3300013308 Bacteria 1367
69 Ga0157380_10000932 3300014326 Bacteria 18464
70 Ga0157377_10060547 3300014745 Bacteria 2162
71 Ga0209129_1004827 3300025258 Bacteria 5074
72 Ga0209758_1000029 3300025297 Bacteria 520787
73 Ga0209758_1000912 3300025297 Bacteria 40017
74 Ga0209758_1003912 3300025297 Bacteria 12996
75 Ga0209758_1014500 3300025297 Bacteria 4183
76 Ga0207426_1000930 3300025302 Bacteria 29211
77 Ga0207705_10000344 3300025909 Bacteria 41940
78 Ga0207684_10000001 3300025910 Bacteria 1115726
79 Ga0207654_10002083 3300025911 Bacteria 10241
80 Ga0207707_10007688 3300025912 Bacteria 9388
81 Ga0207707_10011647 3300025912 Bacteria 7654
82 Ga0207695_10000346 3300025913 Bacteria 107028
83 Ga0207671_10001415 3300025914 Bacteria 27869
84 Ga0207671_10002368 3300025914 Bacteria 20262
85 Ga0207664_10155617 3300025929 Bacteria 1945
86 Ga0207670_10119112 3300025936 Unclassified 1916
87 Ga0207669_10082770 3300025937 Unclassified 2061
88 Ga0207667_10046124 3300025949 Bacteria 4615
89 Ga0207667_10060637 3300025949 Bacteria 3959
90 Ga0207708_10131606 3300026075 Unclassified 1956
91 Ga0207702_10037130 3300026078 Bacteria 4077
92 Ga0207648_10043197 3300026089 Bacteria 3957
93 Ga0207674_10460581 3300026116 Bacteria 1229
94 Ga0207675_100297653 3300026118 Unclassified 1571
95 Ga0268266_10004200 3300028379 Bacteria 13875
96 Ga0265316_10001653 3300031344 Bacteria 23727
97 Ga0307509_10035876 3300031507 Bacteria 5437
98 Ga0307509_10105752 3300031507 Bacteria 2835
99 Ga0307408_100002175 3300031548 Bacteria 14027
100 Ga0307408_100029022 3300031548 Bacteria 3829
101 Ga0307406_10000096 3300031901 Bacteria 50104
102 Ga0307416_100001089 3300032002 Bacteria 14517
103 Ga0307416_100162040 3300032002 Bacteria 2069
104 Ga0307414_10000198 3300032004 Bacteria 40555
105 Ga0307414_10006907 3300032004 Bacteria 6356
106 Ga0307414_10008967 3300032004 Bacteria 5719
107 Ga0395899_0001226 3300037312 Bacteria 22449
108 Ga0395899_0014215 3300037312 Bacteria 6075
109 Ga0395900_0023845 3300037418 Bacteria 6260
110 Ga0395898_0004626 3300037466 Bacteria 15016
111 Ga0395898_0075732 3300037466 Unclassified 3250
112 Ga0395905_0005160 3300037471 Bacteria 13397
113 Ga0395901_0063117 3300038443 Bacteria 3855
114 Ga0395901_0465707 3300038443 Unclassified 1291
115 Ga0451577_0000061 3300042876 Bacteria 268366
116 Ga0451577_0014395 3300042876 Bacteria 7377
117 Ga0453683_0025620 3300044673 Unclassified 3745
118 Ga0453683_0108337 3300044673 Bacteria 1746
119 Ga0453684_0000084 3300044712 Bacteria 398306
120 Ga0453684_0000396 3300044712 Bacteria 179548
121 Ga0453684_0014026 3300044712 Bacteria 12896
122 Ga0453684_0014869 3300044712 Bacteria 12379
123 Ga0453684_0033653 3300044712 Bacteria 7139
124 Ga0453684_0264329 3300044712 Bacteria 1969
125 Ga0453684_0351462 3300044712 Bacteria 1662
126 Ga0451576_0000015 3300045051 Bacteria 579908
127 Ga0451576_0000179 3300045051 Bacteria 159850
128 Ga0451576_0009348 3300045051 Bacteria 11372
129 Ga0451576_0019869 3300045051 Bacteria 7325
130 Ga0451576_0221027 3300045051 Bacteria 1977
131 Ga0495650_0001897 3300046471 Bacteria 18549
132 Ga0495625_0047017 3300046660 Bacteria 3112
133 Ga0496122_0000100 3300048925 Bacteria 197832
134 Ga0496126_0000106 3300048929 Bacteria 197818
135 Ga0501300_004682 3300049523 Bacteria 2023
136 Ga0501046_0000006 3300049580 Bacteria 368565
137 Ga0501257_017325 3300049686 Unclassified 1675
138 Ga0501080_0127836 3300049742 Bacteria 2353
139 Ga0501241_000308 3300049758 Bacteria 10678
140 Ga0501044_0029121 3300049823 Bacteria 5824
141 nmdc:mga0k408_19299_c1 3300050493 Bacteria 3808
142 Ga0500646_0023761 3300053090 Bacteria 1646
143 Ga0500641_0000062 3300053096 Bacteria 45077
144 Ga0500562_000005 3300053108 Bacteria 266746
145 Ga0500652_002430 3300053131 Bacteria 5610
146 Ga0500568_0019706 3300053139 Bacteria 2926
147 Ga0500616_0007997 3300053153 Bacteria 6630
148 2644009238 2643221600 Bacteria 5530138
149 2719183376 2718217882 Bacteria 6556348
150 2719734093 2718218009 Bacteria 6478651
151 2721149488 2718218363 Bacteria 6524337
152 2721160891 2718218365 Bacteria 6274507
153 2721166325 2718218366 Bacteria 6425255
154 2722842495 2721755514 Bacteria 6424414
155 2724046849 2721755810 Bacteria 6479005
156 2730166611 2728369365 Bacteria 6555560
157 2730300523 2728369397 Bacteria 6274511
158 2793282141 2791355253 Bacteria 5171699
159 2793349637 2791355264 Bacteria 6429314
160 2793358485 2791355266 Bacteria 7116587
161 2842344609 2842341865 Bacteria 7003929
162 2842367813 2842363717 Bacteria 6844742
163 2842908208 2842903701 Bacteria 6986368
164 2919194265 2919191525 Bacteria 5765973
165 2929244003 2929239360 Bacteria 7745570
166 2954020853 2954016120 Bacteria 6446024
167 8055305100 8055301274 Bacteria 8587385
168 rootL2_10003685
169 JGI24740J21852_10006356
170 JGI25153J46596_10000062
171 JGI25153J46596_10000781
172 JGI25153J46596_10007646
173 rootH2_10019643
174 rootH2_10202053
175 rootL2_10131310
176 rootH1_10003366
177 rootH1_10004759
178 rootH1_10011717
179 rootH1_10011718
180 rootH1_10258632
181 JGI25160J50197_1005101
182 Ga0065165_1022402
183 Ga0070658_10000596
184 Ga0070682_100043550
185 Ga0070687_100043451
186 Ga0070675_100347971
187 Ga0070671_100009954
188 Ga0070674_100035752
189 Ga0070674_100107906
190 Ga0070673_100028054
191 Ga0070673_100191455
192 Ga0070703_10001632
193 Ga0070701_10159933
194 Ga0070700_100029629
195 Ga0070708_100007003
196 Ga0070681_10008107
197 Ga0070681_10066777
198 Ga0068867_100055765
199 Ga0070706_100002860
200 Ga0070707_100021543
201 Ga0070698_100054758
202 Ga0070699_100002010
203 Ga0070697_100005273
204 Ga0070686_100018111
205 Ga0070665_100001783
206 Ga0068855_100001663
207 Ga0068855_100075064
208 Ga0068855_100278270
209 Ga0068861_100297541
210 Ga0075366_10016102
211 Ga0105240_10000198
212 Ga0105240_10013476
213 Ga0105240_10144173
214 Ga0105240_10229148
215 Ga0105241_10000137
216 Ga0105237_10000781
217 Ga0105237_10003050
218 Ga0105237_10006169
219 Ga0105238_10006856
220 Ga0105238_10172398
221 Ga0105239_10000298
222 Ga0105239_10001227
223 Ga0105239_10005875
224 Ga0105239_10008489
225 Ga0157371_10121358
226 Ga0157370_10000485
227 Ga0157370_10001243
228 Ga0157370_10002152
229 Ga0157374_10011375
230 Ga0157378_10005467
231 Ga0157378_10032839
232 Ga0157372_10033145
233 Ga0157372_10039763
234 Ga0157375_10509638
235 Ga0157380_10000932
236 Ga0157377_10060547
237 Ga0209129_1004827
238 Ga0209758_1000029
239 Ga0209758_1000912
240 Ga0209758_1003912
241 Ga0209758_1014500
242 Ga0207426_1000930
243 Ga0207705_10000344
244 Ga0207684_10000001
245 Ga0207654_10002083
246 Ga0207707_10007688
247 Ga0207707_10011647
248 Ga0207695_10000346
249 Ga0207671_10001415
250 Ga0207671_10002368
251 Ga0207664_10155617
252 Ga0207670_10119112
253 Ga0207669_10082770
254 Ga0207667_10046124
255 Ga0207667_10060637
256 Ga0207708_10131606
257 Ga0207702_10037130
258 Ga0207648_10043197
259 Ga0207674_10460581
260 Ga0207675_100297653
261 Ga0268266_10004200
262 Ga0265316_10001653
263 Ga0307509_10035876
264 Ga0307509_10105752
265 Ga0307408_100002175
266 Ga0307408_100029022
267 Ga0307406_10000096
268 Ga0307416_100001089
269 Ga0307416_100162040
270 Ga0307414_10000198
271 Ga0307414_10006907
272 Ga0307414_10008967
273 Ga0395899_0001226
274 Ga0395899_0014215
275 Ga0395900_0023845
276 Ga0395898_0004626
277 Ga0395898_0075732
278 Ga0395905_0005160
279 Ga0395901_0063117
280 Ga0395901_0465707
281 Ga0451577_0000061
282 Ga0451577_0014395
283 Ga0453683_0025620
284 Ga0453683_0108337
285 Ga0453684_0000084
286 Ga0453684_0000396
287 Ga0453684_0014026
288 Ga0453684_0014869
289 Ga0453684_0033653
290 Ga0453684_0264329
291 Ga0453684_0351462
292 Ga0451576_0000015
293 Ga0451576_0000179
294 Ga0451576_0009348
295 Ga0451576_0019869
296 Ga0451576_0221027
297 Ga0495650_0001897
298 Ga0495625_0047017
299 Ga0496122_0000100
300 Ga0496126_0000106
301 Ga0501300_004682
302 Ga0501046_0000006
303 Ga0501257_017325
304 Ga0501080_0127836
305 Ga0501241_000308
306 Ga0501044_0029121
307 nmdc:mga0k408_19299_c1
308 Ga0500646_0023761
309 Ga0500641_0000062
310 Ga0500562_000005
311 Ga0500652_002430
312 Ga0500568_0019706
313 Ga0500616_0007997
314 2644009238
315 2719183376
316 2719734093
317 2721149488
318 2721160891
319 2721166325
320 2722842495
321 2724046849
322 2730166611
323 2730300523
324 2793282141
325 2793349637
326 2793358485
327 2842344609
328 2842367813
329 2842908208
330 2919194265
331 2929244003
332 2954020853
333 8055305100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03102

NeuB

NeuB family

48

292

0.96

PF08666

SAF

SAF domain

306

364

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ncs-assembly1.cif.gz_B crystal structure of n-acetylneuraminic acid (sialic acid) synthetase from leptospira borgpetersenii serovar hardjo-bovis in complex with citrate 0.9326 3 276
8h2c-assembly2.cif.gz_D crystal structure of the pseudaminic acid synthase psei from campylobacter jejuni 0.9277 2 333
8h2c-assembly2.cif.gz_C crystal structure of the pseudaminic acid synthase psei from campylobacter jejuni 0.9274 2 333
5xqp-assembly2.cif.gz_D-2 crystal structure of notched-fin eelpout type iii antifreeze protein (nfe6, afp), p212121 form 0.9254 281 332
5xqu-assembly1.cif.gz_A crystal structure of notched-fin eelpout type iii antifreeze protein a20i mutant (nfe6, afp), p212121 form 0.9248 281 332
ID Description Score Start End Superfamily
af_Q58465_3_262_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9726 3 265 3.20.20.70
1wvoA00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9535 282 332 3.90.1210.10
2wqpA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9348 3 266 3.20.20.70
5xqrB00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9336 281 332 3.90.1210.10
af_Q9VG74_312_372_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9317 281 332 3.90.1210.10
ID Description Score Start End GO Terms
AF-A0A7C0ZYS9-F1-model_v4 N-acetylneuraminic acid synthase N-terminal domain-containing protein 0.9913 1 247 GO:0016051
GO:0047444
GO:0070085
AF-A0A3A9EP61-F1-model_v4 N-acetylneuraminate synthase (EC 2.5.1.56) 0.9896 1 250 GO:0016051
GO:0047444
GO:0050462
GO:0070085
AF-A0A521RYM6-F1-model_v4 N-acetylneuraminate synthase 0.9872 5 122 GO:0016051
GO:0047444
GO:0070085
AF-A0A2V6CTW1-F1-model_v4 N-acetylneuraminate synthase 0.987 3 222 GO:0016051
GO:0047444
GO:0070085
AF-A0A3A9EP61-F1-model_v4 N-acetylneuraminate synthase (EC 2.5.1.56) 0.9857 1 250 GO:0016051
GO:0047444
GO:0050462
GO:0070085

Map