F248357

General Info

Members Datasets Scaffolds Average Seq Length
166 99 154 208

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000188|Ga0157373_1000018833
Length 213
Sequence MAQIYRIYINQKVLLITESAPKHLKKFQQIDHQNFDLKIIYPLILEHYPGHNFFVICTDAKAFFKQITKNITVIRAAGGLVKNERKEYLFIYRNDKWDLPKGKIEKGEKIKECAVREVEEECGIKVKKLGKKIGKTYHAYIYRGEVVLKKSYWYKMRCEGFDKLKPQKEEGITDARWLTPEKMGIVTKNTFPSIAEVMEKTGLIKDTAGLLSE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
71 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
72 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
83 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
89 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
90 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
95 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
96 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
97 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
98 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
99 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0
Rhizoplane 0.6
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
2 JGI25157J39369_1002605 3300002741 Bacteria 4289
3 rootH1_10218449 3300003323 Bacteria 9817
4 rootH1_10239678 3300003323 Bacteria 1852
5 Ga0065714_10002298 3300005288 Bacteria 48008
6 Ga0065714_10002621 3300005288 Bacteria 31326
7 Ga0065714_10014983 3300005288 Bacteria 2330
8 Ga0065714_10015655 3300005288 Bacteria 1460
9 Ga0065714_10021565 3300005288 Bacteria 2010
10 Ga0065714_10084878 3300005288 Bacteria 2175
11 Ga0065704_10000205 3300005289 Bacteria 128899
12 Ga0065704_10001103 3300005289 Bacteria 14777
13 Ga0070658_10208454 3300005327 Bacteria 1651
14 Ga0070683_100017009 3300005329 Bacteria 6418
15 Ga0070660_100085767 3300005339 Bacteria 2477
16 Ga0070659_100001238 3300005366 Bacteria 18539
17 Ga0068855_100015438 3300005563 Bacteria 9194
18 Ga0068856_100004452 3300005614 Bacteria 13956
19 Ga0068856_100047426 3300005614 Bacteria 4232
20 Ga0075366_10005129 3300006195 Bacteria 7086
21 Ga0075366_10034894 3300006195 Bacteria 2964
22 Ga0075370_10102441 3300006353 Bacteria 1658
23 Ga0105240_10043386 3300009093 Bacteria 5723
24 Ga0105240_10100425 3300009093 Bacteria 3521
25 Ga0105240_10617063 3300009093 Bacteria 1192
26 Ga0105241_10055333 3300009174 Bacteria 3039
27 Ga0105241_10098405 3300009174 Bacteria 2321
28 Ga0105241_10262102 3300009174 Bacteria 1469
29 Ga0105241_10546453 3300009174 Bacteria 1039
30 Ga0105242_10406279 3300009176 Bacteria 1272
31 Ga0105237_10000417 3300009545 Bacteria 60658
32 Ga0105237_10004270 3300009545 Bacteria 16609
33 Ga0105237_10023025 3300009545 Bacteria 6388
34 Ga0105237_10059196 3300009545 Bacteria 3832
35 Ga0105237_10086203 3300009545 Bacteria 3130
36 Ga0105238_10187538 3300009551 Bacteria 2044
37 Ga0105239_10000005 3300010375 Bacteria 496066
38 Ga0105239_10000010 3300010375 Bacteria 341545
39 Ga0105239_10000415 3300010375 Bacteria 62156
40 Ga0105239_10000482 3300010375 Bacteria 58131
41 Ga0105239_10006733 3300010375 Bacteria 13275
42 Ga0105239_10719161 3300010375 Bacteria 1142
43 Ga0157373_10000188 3300013100 Bacteria 50875
44 Ga0157373_10006545 3300013100 Bacteria 8692
45 Ga0157373_10120928 3300013100 Bacteria 1840
46 Ga0157373_10204430 3300013100 Bacteria 1392
47 Ga0157371_10001534 3300013102 Bacteria 23793
48 Ga0157371_10010487 3300013102 Bacteria 7211
49 Ga0157371_10010623 3300013102 Bacteria 7152
50 Ga0157370_10004633 3300013104 Bacteria 15727
51 Ga0157370_10056450 3300013104 Bacteria 3738
52 Ga0157370_10062863 3300013104 Bacteria 3520
53 Ga0157370_10192127 3300013104 Bacteria 1895
54 Ga0157370_10403460 3300013104 Bacteria 1258
55 Ga0157370_10462240 3300013104 Bacteria 1166
56 Ga0157369_10157793 3300013105 Bacteria 2396
57 Ga0157369_10180257 3300013105 Bacteria 2223
58 Ga0157369_10191497 3300013105 Bacteria 2149
59 Ga0157374_10059021 3300013296 Bacteria 3586
60 Ga0157374_10687707 3300013296 Bacteria 1036
61 Ga0157378_10077124 3300013297 Bacteria 3004
62 Ga0163162_10045474 3300013306 Bacteria 4398
63 Ga0157372_10000458 3300013307 Bacteria 44772
64 Ga0157372_10000743 3300013307 Bacteria 35537
65 Ga0157372_10271689 3300013307 Bacteria 1970
66 Ga0157372_10427205 3300013307 Bacteria 1544
67 Ga0182008_10000069 3300014497 Bacteria 82281
68 Ga0182008_10000247 3300014497 Bacteria 41952
69 Ga0182006_1000210 3300015261 Bacteria 57485
70 Ga0182006_1009379 3300015261 Bacteria 4387
71 Ga0163161_10000572 3300017792 Bacteria 29561
72 Ga0163161_10001264 3300017792 Bacteria 18909
73 Ga0209026_1001326 3300025250 Bacteria 11129
74 Ga0209129_1009490 3300025258 Bacteria 2555
75 Ga0207705_10126792 3300025909 Bacteria 1898
76 Ga0207654_10068625 3300025911 Bacteria 2098
77 Ga0207695_10000013 3300025913 Bacteria 821265
78 Ga0207671_10006914 3300025914 Bacteria 9999
79 Ga0207671_10097149 3300025914 Bacteria 2227
80 Ga0207690_10000943 3300025932 Bacteria 18615
81 Ga0207686_10482415 3300025934 Bacteria 959
82 Ga0207669_10100446 3300025937 Bacteria 1911
83 Ga0207661_10041014 3300025944 Bacteria 3642
84 Ga0207667_10000956 3300025949 Bacteria 36853
85 Ga0207667_10039499 3300025949 Bacteria 5030
86 Ga0207702_10000196 3300026078 Bacteria 71703
87 Ga0207702_10130414 3300026078 Bacteria 2262
88 Ga0307515_10002169 3300028794 Bacteria 43093
89 Ga0307515_10005018 3300028794 Bacteria 27006
90 Ga0307515_10132717 3300028794 Bacteria 2730
91 Ga0307512_10228055 3300030522 Bacteria 962
92 Ga0307412_10000004 3300031911 Bacteria 544053
93 Ga0307414_10000477 3300032004 Bacteria 20980
94 Ga0307414_10007084 3300032004 Bacteria 6289
95 Ga0307414_10023212 3300032004 Bacteria 3930
96 Ga0307507_10001977 3300033179 Bacteria 44460
97 Ga0395899_0000002 3300037312 Bacteria 1324310
98 Ga0395901_0531177 3300038443 Bacteria 1194
99 Ga0451577_0000515 3300042876 Bacteria 64793
100 Ga0453684_0806858 3300044712 Bacteria 1012
101 Ga0495651_0038099 3300046462 Bacteria 3744
102 Ga0495651_0622051 3300046462 Bacteria 679
103 Ga0495650_0000003 3300046471 Bacteria 900730
104 Ga0495585_0000136 3300046492 Bacteria 79721
105 Ga0495585_0000987 3300046492 Bacteria 23846
106 Ga0495583_0033913 3300046506 Bacteria 2451
107 Ga0495606_0000002 3300046507 Bacteria 554637
108 Ga0495606_0023190 3300046507 Bacteria 4504
109 Ga0495606_0046666 3300046507 Bacteria 2862
110 Ga0495606_0147302 3300046507 Bacteria 1384
111 Ga0495608_0459709 3300046511 Bacteria 774
112 Ga0495610_0005035 3300046512 Bacteria 9548
113 Ga0495616_0005731 3300046513 Bacteria 7607
114 Ga0495616_0016929 3300046513 Bacteria 4025
115 Ga0495637_0140624 3300046520 Bacteria 916
116 Ga0495648_0001342 3300046524 Bacteria 24327
117 Ga0495652_0296097 3300046529 Bacteria 1178
118 Ga0495609_0007135 3300046538 Bacteria 5618
119 Ga0495609_0158240 3300046538 Bacteria 961
120 Ga0495633_0000069 3300046558 Bacteria 135128
121 Ga0495633_0011918 3300046558 Bacteria 4652
122 Ga0495668_0000494 3300046616 Bacteria 49401
123 Ga0495625_0000005 3300046660 Bacteria 596135
124 Ga0495625_0001977 3300046660 Bacteria 23134
125 Ga0495625_0023001 3300046660 Bacteria 4767
126 Ga0495625_0047523 3300046660 Bacteria 3094
127 Ga0495661_0130571 3300046665 Bacteria 1377
128 Ga0495671_0095795 3300046692 Bacteria 1452
129 Ga0495649_0000003 3300046694 Bacteria 880817
130 Ga0495687_000544 3300047443 Bacteria 45065
131 Ga0495687_071310 3300047443 Bacteria 1392
132 Ga0495673_0067203 3300047469 Bacteria 1518
133 Ga0495686_0002155 3300047472 Bacteria 19212
134 Ga0495686_0004123 3300047472 Bacteria 12092
135 Ga0495686_0015810 3300047472 Bacteria 5136
136 Ga0495686_0037473 3300047472 Bacteria 3106
137 Ga0495686_0177154 3300047472 Bacteria 1237
138 Ga0495686_0239023 3300047472 Bacteria 1025
139 Ga0495614_0005758 3300048089 Bacteria 5580
140 Ga0496122_0001629 3300048925 Bacteria 35029
141 Ga0496123_0000906 3300048926 Bacteria 46669
142 Ga0496125_0206798 3300048928 Bacteria 1279
143 Ga0495678_008538 3300049459 Bacteria 5157
144 Ga0495682_0035819 3300049460 Bacteria 1827
145 Ga0501034_0058653 3300049571 Bacteria 3868
146 Ga0501241_003227 3300049758 Bacteria 3095
147 Ga0501241_025140 3300049758 Bacteria 1108
148 nmdc:mga0k408_1588_c1 3300050493 Bacteria 12290
149 Ga0500635_0000304 3300053080 Bacteria 17218
150 Ga0500651_0000207 3300053093 Bacteria 36951
151 Ga0500608_020954 3300053122 Bacteria 3015
152 Ga0500618_000002 3300053125 Bacteria 370822
153 Ga0500568_0060152 3300053139 Bacteria 1472
154 Ga0500624_000771 3300053157 Bacteria 7663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100015438 Ga0068855_1000154387 177
2 3300025949 Ga0207667_10000956 Ga0207667_100009567 177
3 3300006195 Ga0075366_10005129 Ga0075366_100051298 179
4 3300013105 Ga0157369_10157793 Ga0157369_101577933 181
5 iso_pu_bacteria 2738541283 2738754290 186
6 3300017792 Ga0163161_10001264 Ga0163161_1000126416 190
7 3300025914 Ga0207671_10097149 Ga0207671_100971492 190
8 3300032004 Ga0307414_10023212 Ga0307414_100232124 190
9 3300005614 Ga0068856_100004452 Ga0068856_10000445210 191
10 3300026078 Ga0207702_10000196 Ga0207702_1000019614 191
11 3300030522 Ga0307512_10228055 Ga0307512_102280552 191
12 3300005288 Ga0065714_10015655 Ga0065714_100156552 195
13 3300049571 Ga0501034_0058653 Ga0501034_0058653_1167_1769 197
14 3300002741 JGI25157J39369_1002605 JGI25157J39369_10026054 198
15 3300005339 Ga0070660_100085767 Ga0070660_1000857676 198
16 3300005366 Ga0070659_100001238 Ga0070659_10000123818 198
17 3300025250 Ga0209026_1001326 Ga0209026_10013265 198
18 3300025932 Ga0207690_10000943 Ga0207690_100009439 198
19 3300003323 rootH1_10218449 rootH1_102184494 200
20 3300005329 Ga0070683_100017009 Ga0070683_1000170095 200
21 3300025944 Ga0207661_10041014 Ga0207661_100410144 200
22 3300009176 Ga0105242_10406279 Ga0105242_104062792 202
23 3300009545 Ga0105237_10004270 Ga0105237_100042705 202
24 3300013100 Ga0157373_10204430 Ga0157373_102044302 202
25 3300013104 Ga0157370_10004633 Ga0157370_100046338 202
26 3300014497 Ga0182008_10000247 Ga0182008_100002478 202
27 3300015261 Ga0182006_1000210 Ga0182006_100021044 202
28 3300015261 Ga0182006_1009379 Ga0182006_10093795 202
29 3300025934 Ga0207686_10482415 Ga0207686_104824152 202
30 3300028794 Ga0307515_10132717 Ga0307515_101327171 202
31 3300048925 Ga0496122_0001629 Ga0496122_0001629_1126_1737 202
32 3300048926 Ga0496123_0000906 Ga0496123_0000906_44549_45160 202
33 3300048928 Ga0496125_0206798 Ga0496125_0206798_189_800 202
34 iso_pu_bacteria 2738543023 2739301648 202
35 iso_pu_bacteria 2775506987 2776614556 202
36 3300046513 Ga0495616_0005731 Ga0495616_0005731_1314_1952 203
37 3300046660 Ga0495625_0000005 Ga0495625_0000005_307290_307928 203
38 3300046692 Ga0495671_0095795 Ga0495671_0095795_527_1165 203
39 3300046694 Ga0495649_0000003 Ga0495649_0000003_307278_307916 203
40 iso_pu_bacteria 2852627209 2852627685 203
41 iso_pu_bacteria 2919186247 2919187856 203
42 3300013100 Ga0157373_10006545 Ga0157373_100065455 205
43 3300042876 Ga0451577_0000515 Ga0451577_0000515_31007_31627 205
44 3300044712 Ga0453684_0806858 Ga0453684_0806858_344_964 205
45 3300003323 rootH1_10239678 rootH1_102396783 206
46 3300005289 Ga0065704_10001103 Ga0065704_100011035 206
47 3300005614 Ga0068856_100047426 Ga0068856_1000474262 206
48 3300006353 Ga0075370_10102441 Ga0075370_101024411 206
49 3300009174 Ga0105241_10262102 Ga0105241_102621022 206
50 3300009174 Ga0105241_10546453 Ga0105241_105464532 206
51 3300009545 Ga0105237_10023025 Ga0105237_100230253 206
52 3300009551 Ga0105238_10187538 Ga0105238_101875382 206
53 3300010375 Ga0105239_10000010 Ga0105239_10000010101 206
54 3300013104 Ga0157370_10462240 Ga0157370_104622402 206
55 3300017792 Ga0163161_10000572 Ga0163161_1000057214 206
56 3300025914 Ga0207671_10006914 Ga0207671_100069142 206
57 3300026078 Ga0207702_10130414 Ga0207702_101304142 206
58 3300047472 Ga0495686_0177154 Ga0495686_0177154_595_1218 206
59 3300005288 Ga0065714_10014983 Ga0065714_100149832 207
60 3300005288 Ga0065714_10021565 Ga0065714_100215653 207
61 3300009093 Ga0105240_10043386 Ga0105240_100433864 207
62 3300009174 Ga0105241_10055333 Ga0105241_100553332 207
63 3300009545 Ga0105237_10086203 Ga0105237_100862033 207
64 3300010375 Ga0105239_10000415 Ga0105239_1000041546 207
65 3300025937 Ga0207669_10100446 Ga0207669_101004462 207
66 3300046462 Ga0495651_0038099 Ga0495651_0038099_1390_2016 207
67 3300046462 Ga0495651_0622051 Ga0495651_0622051_33_659 207
68 3300046511 Ga0495608_0459709 Ga0495608_0459709_64_690 207
69 3300046529 Ga0495652_0296097 Ga0495652_0296097_88_714 207
70 iso_pu_bacteria 2939664404 2939664877 207
71 iso_pu_bacteria 2599185184 2599477968 208
72 iso_pu_bacteria 2919437846 2919440742 208
73 iso_pu_bacteria 2928078545 2928079929 208
74 iso_pu_bacteria 2928147474 2928147616 208
75 iso_pu_bacteria 2932082852 2932083626 208
76 3300013104 Ga0157370_10403460 Ga0157370_104034602 209
77 3300046506 Ga0495583_0033913 Ga0495583_0033913_1367_2002 209
78 3300046507 Ga0495606_0023190 Ga0495606_0023190_3400_4032 209
79 3300046513 Ga0495616_0016929 Ga0495616_0016929_2710_3342 209
80 3300046660 Ga0495625_0023001 Ga0495625_0023001_347_979 209
81 3300046660 Ga0495625_0047523 Ga0495625_0047523_906_1538 209
82 3300047443 Ga0495687_071310 Ga0495687_071310_181_813 209
83 3300047472 Ga0495686_0004123 Ga0495686_0004123_10362_10994 209
84 3300047472 Ga0495686_0239023 Ga0495686_0239023_142_774 209
85 3300049459 Ga0495678_008538 Ga0495678_008538_2421_3053 209
86 3300053122 Ga0500608_020954 Ga0500608_020954_1521_2153 209
87 3300053125 Ga0500618_000002 Ga0500618_000002_195855_196487 209
88 3300005288 Ga0065714_10084878 Ga0065714_100848781 210
89 3300032004 Ga0307414_10007084 Ga0307414_100070843 210
90 3300005327 Ga0070658_10208454 Ga0070658_102084542 211
91 3300006195 Ga0075366_10034894 Ga0075366_100348945 211
92 3300009093 Ga0105240_10100425 Ga0105240_101004255 211
93 3300009093 Ga0105240_10617063 Ga0105240_106170632 211
94 3300009174 Ga0105241_10098405 Ga0105241_100984052 211
95 3300009545 Ga0105237_10000417 Ga0105237_1000041718 211
96 3300009545 Ga0105237_10059196 Ga0105237_100591961 211
97 3300010375 Ga0105239_10000005 Ga0105239_10000005435 211
98 3300010375 Ga0105239_10000482 Ga0105239_1000048227 211
99 3300010375 Ga0105239_10006733 Ga0105239_1000673317 211
100 3300010375 Ga0105239_10719161 Ga0105239_107191612 211
101 3300013100 Ga0157373_10000188 Ga0157373_1000018833 211
102 3300013100 Ga0157373_10120928 Ga0157373_101209283 211
103 3300013102 Ga0157371_10001534 Ga0157371_1000153419 211
104 3300013104 Ga0157370_10062863 Ga0157370_100628633 211
105 3300013105 Ga0157369_10180257 Ga0157369_101802572 211
106 3300013105 Ga0157369_10191497 Ga0157369_101914973 211
107 3300013296 Ga0157374_10059021 Ga0157374_100590215 211
108 3300013296 Ga0157374_10687707 Ga0157374_106877072 211
109 3300013297 Ga0157378_10077124 Ga0157378_100771242 211
110 3300013306 Ga0163162_10045474 Ga0163162_100454746 211
111 3300013307 Ga0157372_10000458 Ga0157372_1000045829 211
112 3300013307 Ga0157372_10000743 Ga0157372_1000074315 211
113 3300013307 Ga0157372_10271689 Ga0157372_102716894 211
114 3300013307 Ga0157372_10427205 Ga0157372_104272052 211
115 3300025258 Ga0209129_1009490 Ga0209129_10094902 211
116 3300025909 Ga0207705_10126792 Ga0207705_101267921 211
117 3300025911 Ga0207654_10068625 Ga0207654_100686254 211
118 3300025913 Ga0207695_10000013 Ga0207695_10000013195 211
119 3300025949 Ga0207667_10039499 Ga0207667_100394998 211
120 3300028794 Ga0307515_10002169 Ga0307515_1000216922 211
121 3300028794 Ga0307515_10005018 Ga0307515_1000501815 211
122 3300033179 Ga0307507_10001977 Ga0307507_1000197717 211
123 3300037312 Ga0395899_0000002 Ga0395899_0000002_1273924_1274562 211
124 3300038443 Ga0395901_0531177 Ga0395901_0531177_453_1091 211
125 3300046471 Ga0495650_0000003 Ga0495650_0000003_190286_190924 211
126 3300046492 Ga0495585_0000136 Ga0495585_0000136_1306_1944 211
127 3300046492 Ga0495585_0000987 Ga0495585_0000987_9278_9916 211
128 3300046507 Ga0495606_0000002 Ga0495606_0000002_527698_528336 211
129 3300046507 Ga0495606_0046666 Ga0495606_0046666_231_869 211
130 3300046507 Ga0495606_0147302 Ga0495606_0147302_193_831 211
131 3300046512 Ga0495610_0005035 Ga0495610_0005035_2227_2865 211
132 3300046520 Ga0495637_0140624 Ga0495637_0140624_101_739 211
133 3300046524 Ga0495648_0001342 Ga0495648_0001342_2552_3190 211
134 3300046538 Ga0495609_0007135 Ga0495609_0007135_3445_4083 211
135 3300046538 Ga0495609_0158240 Ga0495609_0158240_34_672 211
136 3300046558 Ga0495633_0000069 Ga0495633_0000069_15202_15840 211
137 3300046558 Ga0495633_0011918 Ga0495633_0011918_3823_4461 211
138 3300046616 Ga0495668_0000494 Ga0495668_0000494_4468_5106 211
139 3300046660 Ga0495625_0001977 Ga0495625_0001977_11090_11728 211
140 3300046665 Ga0495661_0130571 Ga0495661_0130571_254_892 211
141 3300047443 Ga0495687_000544 Ga0495687_000544_26498_27136 211
142 3300047469 Ga0495673_0067203 Ga0495673_0067203_64_702 211
143 3300047472 Ga0495686_0002155 Ga0495686_0002155_2490_3128 211
144 3300047472 Ga0495686_0015810 Ga0495686_0015810_1774_2412 211
145 3300047472 Ga0495686_0037473 Ga0495686_0037473_1646_2284 211
146 3300048089 Ga0495614_0005758 Ga0495614_0005758_3998_4636 211
147 3300049460 Ga0495682_0035819 Ga0495682_0035819_666_1304 211
148 3300050493 nmdc:mga0k408_1588_c1 nmdc:mga0k408_1588_c1_4025_4663 211
149 3300053080 Ga0500635_0000304 Ga0500635_0000304_4116_4754 211
150 3300053157 Ga0500624_000771 Ga0500624_000771_5303_5941 211
151 iso_pu_bacteria 2738541284 2738762948 214
152 2162886007 SwRhRL2b_contig_475676 SwRhRL2b_0167.00008640 218
153 3300005288 Ga0065714_10002298 Ga0065714_1000229824 218
154 3300005288 Ga0065714_10002621 Ga0065714_1000262113 218
155 3300005289 Ga0065704_10000205 Ga0065704_1000020510 218
156 3300013102 Ga0157371_10010487 Ga0157371_100104874 218
157 3300013102 Ga0157371_10010623 Ga0157371_100106232 218
158 3300013104 Ga0157370_10056450 Ga0157370_100564505 218
159 3300013104 Ga0157370_10192127 Ga0157370_101921272 218
160 3300014497 Ga0182008_10000069 Ga0182008_1000006957 218
161 3300031911 Ga0307412_10000004 Ga0307412_10000004366 218
162 3300032004 Ga0307414_10000477 Ga0307414_1000047711 218
163 3300049758 Ga0501241_003227 Ga0501241_003227_964_1623 218
164 3300049758 Ga0501241_025140 Ga0501241_025140_261_917 218
165 3300053093 Ga0500651_0000207 Ga0500651_0000207_5407_6063 218
166 3300053139 Ga0500568_0060152 Ga0500568_0060152_598_1254 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

72

201

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.8787 70 206
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.8652 72 204
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.86 70 206
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.846 72 204
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.8424 70 200
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8876 74 204 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8794 74 198 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8744 74 204 3.90.79.10
af_P9WIX7_56_205_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8459 69 202 3.90.79.10
4kyxB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8403 69 197 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4R5MHJ0-F1-model_v4 NUDIX domain-containing protein 0.9902 2 202 GO:0004081
GO:0006167
GO:0006754
AF-A0A519NN58-F1-model_v4 deleted 0.9866 72 202
AF-A0A5P2FWP3-F1-model_v4 NUDIX domain-containing protein 0.9801 69 202 GO:0016787
AF-A0A4R5MHJ0-F1-model_v4 NUDIX domain-containing protein 0.9757 2 202 GO:0004081
GO:0006167
GO:0006754
AF-A0A4R2YYJ7-F1-model_v4 deleted 0.9756 2 202

Feature Viewer

pLDDT pTM Quality
88.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map