F248797

General Info

Members Datasets Scaffolds Average Seq Length
166 93 332 405

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0061107|Ga0373937_0061107_1086_2435
Length 449
Sequence MSAGIECKKAARMADVVNAGYPGYCLQTMDALPTVLLRPGEGDRIVAGHPWVYQGEILRLTSTVADGDLVQVKDHRQRFLGVGFFNAKSKINVRVLSPERVEINEAFFEDRIRAALAVRQKHLPNAASFRVVNAESDFLSGLIVDKYEDVLVVQISSLGMDRRKTQIVAALAKIFSPRAILERGDIASRKFEGLAEANGVLAGEFGDRKALSASSETGGNADKTVRAPRITVDLNGLKFETDLAAGHKTGLYLDQQVNYQAVAQFARGAQVLDCFSFLGGFGLHAARAGAAHVHLLDQSAEAIAASQRNATANRLADICSFEAVNVFDWLKSQTAVKPHEKVVPRFDLIVLDPPSFTRNRASVPDALRGYKEIHLRALKLLRAGGTLATFCCSHHVDATTFQDVILSAAYDTRRILRRVATYSQSLDHPVIPMIPETEYLKGFAFEVVR

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
54 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
57 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 24.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0061107 3300036401 Unclassified 3463
2 rootH2_10049688 3300003320 Bacteria 10834
3 rootH2_10073321 3300003320 Bacteria 2055
4 Ga0070683_100284514 3300005329 Unclassified 1573
5 Ga0070690_100186894 3300005330 Bacteria 1434
6 Ga0070689_100099444 3300005340 Unclassified 2301
7 Ga0070691_10066335 3300005341 Bacteria 1744
8 Ga0070714_100006729 3300005435 Bacteria 8906
9 Ga0070711_100004225 3300005439 Bacteria 8439
10 Ga0070679_100198202 3300005530 Unclassified 1974
11 Ga0070679_100199118 3300005530 Bacteria 1969
12 Ga0070686_100083389 3300005544 Unclassified 2122
13 Ga0070686_100159421 3300005544 Bacteria 1588
14 Ga0068855_100040042 3300005563 Bacteria 5562
15 Ga0068857_100070247 3300005577 Bacteria 3119
16 Ga0068856_100000264 3300005614 Bacteria 57155
17 Ga0068859_100027096 3300005617 Bacteria 5749
18 Ga0068859_100498177 3300005617 Unclassified 1313
19 Ga0081455_10077252 3300005937 Unclassified 2739
20 Ga0097620_100027096 3300006931 Bacteria 5749
21 Ga0097620_100498217 3300006931 Unclassified 1313
22 Ga0099794_10048990 3300007265 Unclassified 2029
23 Ga0105240_10008225 3300009093 Bacteria 14951
24 Ga0105240_10347508 3300009093 Bacteria 1683
25 Ga0111539_10151420 3300009094 Unclassified 2715
26 Ga0105242_10162316 3300009176 Bacteria 1957
27 Ga0105238_10071013 3300009551 Bacteria 3480
28 Ga0157378_10132624 3300013297 Bacteria 2307
29 Ga0157375_10047678 3300013308 Unclassified 4186
30 Ga0163163_10000049 3300014325 Bacteria 130036
31 Ga0163163_10130104 3300014325 Bacteria 2557
32 Ga0207707_10195462 3300025912 Unclassified 1764
33 Ga0207695_10031221 3300025913 Bacteria 5848
34 Ga0207695_10096702 3300025913 Bacteria 2954
35 Ga0207695_10158296 3300025913 Bacteria 2198
36 Ga0207695_10325977 3300025913 Unclassified 1425
37 Ga0207663_10002973 3300025916 Bacteria 8198
38 Ga0207694_10062568 3300025924 Bacteria 2897
39 Ga0207664_10005143 3300025929 Bacteria 8913
40 Ga0207670_10181329 3300025936 Unclassified 1586
41 Ga0207703_10309900 3300026035 Unclassified 1443
42 Ga0207702_10004495 3300026078 Bacteria 12379
43 Ga0207674_10085496 3300026116 Unclassified 3149
44 Ga0265337_1000339 3300028556 Bacteria 24999
45 Ga0265337_1005919 3300028556 Bacteria 4786
46 Ga0265337_1012560 3300028556 Bacteria 2874
47 Ga0265337_1012847 3300028556 Bacteria 2830
48 Ga0265337_1022526 3300028556 Bacteria 1950
49 Ga0265326_10024670 3300028558 Bacteria 1715
50 Ga0265319_1000016 3300028563 Bacteria 176245
51 Ga0265319_1014784 3300028563 Bacteria 3047
52 Ga0265334_10015499 3300028573 Unclassified 3165
53 Ga0265318_10049583 3300028577 Unclassified 1579
54 Ga0265323_10002797 3300028653 Bacteria 7852
55 Ga0265323_10029352 3300028653 Bacteria 2057
56 Ga0265336_10000737 3300028666 Bacteria 17345
57 Ga0265336_10005792 3300028666 Bacteria 4521
58 Ga0265338_10000030 3300028800 Bacteria 260974
59 Ga0265338_10000062 3300028800 Bacteria 196060
60 Ga0265338_10000210 3300028800 Bacteria 107885
61 Ga0265338_10000723 3300028800 Bacteria 56376
62 Ga0265338_10001246 3300028800 Bacteria 41955
63 Ga0265338_10001539 3300028800 Bacteria 37247
64 Ga0265338_10002993 3300028800 Bacteria 24469
65 Ga0265338_10003708 3300028800 Bacteria 21260
66 Ga0265338_10004221 3300028800 Bacteria 19557
67 Ga0265338_10005003 3300028800 Bacteria 17529
68 Ga0265338_10009072 3300028800 Bacteria 11963
69 Ga0265338_10020924 3300028800 Bacteria 6848
70 Ga0265338_10028809 3300028800 Bacteria 5527
71 Ga0265338_10029053 3300028800 Bacteria 5494
72 Ga0265338_10029195 3300028800 Bacteria 5474
73 Ga0265338_10032138 3300028800 Bacteria 5127
74 Ga0265338_10099320 3300028800 Bacteria 2378
75 Ga0265338_10169036 3300028800 Unclassified 1679
76 Ga0265338_10205470 3300028800 Bacteria 1482
77 Ga0265324_10000218 3300029957 Bacteria 44125
78 Ga0265324_10000888 3300029957 Bacteria 19007
79 Ga0265324_10004259 3300029957 Bacteria 6535
80 Ga0265324_10031422 3300029957 Bacteria 1859
81 Ga0265328_10008983 3300031239 Unclassified 4092
82 Ga0265320_10000471 3300031240 Bacteria 31514
83 Ga0265320_10001558 3300031240 Bacteria 16509
84 Ga0265320_10010078 3300031240 Unclassified 5651
85 Ga0265320_10021997 3300031240 Bacteria 3420
86 Ga0265320_10075607 3300031240 Bacteria 1580
87 Ga0265325_10012188 3300031241 Unclassified 4919
88 Ga0265329_10000279 3300031242 Bacteria 27064
89 Ga0265329_10015203 3300031242 Bacteria 2694
90 Ga0265340_10015114 3300031247 Bacteria 4016
91 Ga0265340_10030161 3300031247 Bacteria 2720
92 Ga0265339_10116342 3300031249 Bacteria 1378
93 Ga0265327_10002162 3300031251 Bacteria 21650
94 Ga0265327_10018661 3300031251 Bacteria 4291
95 Ga0265327_10038525 3300031251 Bacteria 2608
96 Ga0265316_10015669 3300031344 Bacteria 6615
97 Ga0265316_10028300 3300031344 Bacteria 4625
98 Ga0265316_10046843 3300031344 Bacteria 3423
99 Ga0265316_10142348 3300031344 Bacteria 1800
100 Ga0265313_10004913 3300031595 Bacteria 10018
101 Ga0265313_10005517 3300031595 Bacteria 9272
102 Ga0265313_10042627 3300031595 Bacteria 2227
103 Ga0265314_10000020 3300031711 Bacteria 307052
104 Ga0265314_10025452 3300031711 Bacteria 4463
105 Ga0316583_10023307 3300032133 Bacteria 2213
106 Ga0373928_0000345 3300035084 Bacteria 9277
107 Ga0373944_0000343 3300035089 Bacteria 10457
108 Ga0373932_0000002 3300035112 Bacteria 711821
109 Ga0373962_0000211 3300035242 Bacteria 12304
110 Ga0373931_0000012 3300035691 Bacteria 267735
111 Ga0373927_0008407 3300035695 Bacteria 6943
112 Ga0373937_0202952 3300036401 Bacteria 1864
113 Ga0373925_0000065 3300037068 Bacteria 114215
114 Ga0373925_0011241 3300037068 Bacteria 6493
115 Ga0373925_0054824 3300037068 Unclassified 2982
116 Ga0451577_0012735 3300042876 Bacteria 7891
117 Ga0453684_0025165 3300044712 Bacteria 8653
118 Ga0453684_0048356 3300044712 Bacteria 5627
119 Ga0453684_0070168 3300044712 Unclassified 4439
120 Ga0451576_0007509 3300045051 Bacteria 13012
121 Ga0451576_0117947 3300045051 Bacteria 2763
122 Ga0451576_0164103 3300045051 Bacteria 2318
123 Ga0495629_0095887 3300046459 Unclassified 2069
124 Ga0495651_0162418 3300046462 Unclassified 1599
125 Ga0495582_0010040 3300046473 Bacteria 5212
126 Ga0495618_0003933 3300046514 Bacteria 9168
127 Ga0495618_0040580 3300046514 Bacteria 2930
128 Ga0495630_0000119 3300046517 Bacteria 62254
129 Ga0495630_0109242 3300046517 Bacteria 2095
130 Ga0495630_0123487 3300046517 Unclassified 1964
131 Ga0495630_0154094 3300046517 Unclassified 1749
132 Ga0495666_0010318 3300046526 Bacteria 4657
133 Ga0495666_0055944 3300046526 Bacteria 1890
134 Ga0495586_0000520 3300046535 Bacteria 22726
135 Ga0495586_0024789 3300046535 Bacteria 3208
136 Ga0495586_0033351 3300046535 Bacteria 2763
137 Ga0495622_0021283 3300046557 Unclassified 3020
138 Ga0495634_0006980 3300046642 Bacteria 8524
139 Ga0495634_0013203 3300046642 Bacteria 5970
140 Ga0495635_0031041 3300046663 Unclassified 3712
141 Ga0495647_0013632 3300046681 Unclassified 2821
142 Ga0495658_0011619 3300046683 Unclassified 4435
143 Ga0495613_0012109 3300046689 Bacteria 6410
144 Ga0495613_0106029 3300046689 Unclassified 2028
145 Ga0495624_0042070 3300046690 Bacteria 2920
146 Ga0495581_0032007 3300047315 Unclassified 3046
147 Ga0495674_0000192 3300047319 Bacteria 49134
148 Ga0495676_0000717 3300047321 Bacteria 27596
149 Ga0495680_0069131 3300047322 Unclassified 2695
150 Ga0495675_0062291 3300047444 Bacteria 2362
151 Ga0495675_0148933 3300047444 Bacteria 1447
152 Ga0501031_0000229 3300049568 Bacteria 31986
153 Ga0501031_0183830 3300049568 Unclassified 1365
154 Ga0501033_0010294 3300049570 Bacteria 7176
155 Ga0501033_0038458 3300049570 Bacteria 3576
156 Ga0501033_0075487 3300049570 Bacteria 2474
157 Ga0501036_0108544 3300049572 Unclassified 2346
158 Ga0501037_0153475 3300049573 Unclassified 1645
159 Ga0501039_0197228 3300049575 Unclassified 1583
160 Ga0501043_0055796 3300049579 Bacteria 3104
161 Ga0501047_0083344 3300049581 Unclassified 3073
162 Ga0501035_0023523 3300049822 Bacteria 5653
163 Ga0501044_0000811 3300049823 Bacteria 37607
164 Ga0501044_0268412 3300049823 Bacteria 1643
165 nmdc:mga08x19_226771_c1 3300050514 Bacteria 1285
166 Ga0500650_0011413 3300053098 Bacteria 3656
167 Ga0373937_0061107
168 rootH2_10049688
169 rootH2_10073321
170 Ga0070683_100284514
171 Ga0070690_100186894
172 Ga0070689_100099444
173 Ga0070691_10066335
174 Ga0070714_100006729
175 Ga0070711_100004225
176 Ga0070679_100198202
177 Ga0070679_100199118
178 Ga0070686_100083389
179 Ga0070686_100159421
180 Ga0068855_100040042
181 Ga0068857_100070247
182 Ga0068856_100000264
183 Ga0068859_100027096
184 Ga0068859_100498177
185 Ga0081455_10077252
186 Ga0097620_100027096
187 Ga0097620_100498217
188 Ga0099794_10048990
189 Ga0105240_10008225
190 Ga0105240_10347508
191 Ga0111539_10151420
192 Ga0105242_10162316
193 Ga0105238_10071013
194 Ga0157378_10132624
195 Ga0157375_10047678
196 Ga0163163_10000049
197 Ga0163163_10130104
198 Ga0207707_10195462
199 Ga0207695_10031221
200 Ga0207695_10096702
201 Ga0207695_10158296
202 Ga0207695_10325977
203 Ga0207663_10002973
204 Ga0207694_10062568
205 Ga0207664_10005143
206 Ga0207670_10181329
207 Ga0207703_10309900
208 Ga0207702_10004495
209 Ga0207674_10085496
210 Ga0265337_1000339
211 Ga0265337_1005919
212 Ga0265337_1012560
213 Ga0265337_1012847
214 Ga0265337_1022526
215 Ga0265326_10024670
216 Ga0265319_1000016
217 Ga0265319_1014784
218 Ga0265334_10015499
219 Ga0265318_10049583
220 Ga0265323_10002797
221 Ga0265323_10029352
222 Ga0265336_10000737
223 Ga0265336_10005792
224 Ga0265338_10000030
225 Ga0265338_10000062
226 Ga0265338_10000210
227 Ga0265338_10000723
228 Ga0265338_10001246
229 Ga0265338_10001539
230 Ga0265338_10002993
231 Ga0265338_10003708
232 Ga0265338_10004221
233 Ga0265338_10005003
234 Ga0265338_10009072
235 Ga0265338_10020924
236 Ga0265338_10028809
237 Ga0265338_10029053
238 Ga0265338_10029195
239 Ga0265338_10032138
240 Ga0265338_10099320
241 Ga0265338_10169036
242 Ga0265338_10205470
243 Ga0265324_10000218
244 Ga0265324_10000888
245 Ga0265324_10004259
246 Ga0265324_10031422
247 Ga0265328_10008983
248 Ga0265320_10000471
249 Ga0265320_10001558
250 Ga0265320_10010078
251 Ga0265320_10021997
252 Ga0265320_10075607
253 Ga0265325_10012188
254 Ga0265329_10000279
255 Ga0265329_10015203
256 Ga0265340_10015114
257 Ga0265340_10030161
258 Ga0265339_10116342
259 Ga0265327_10002162
260 Ga0265327_10018661
261 Ga0265327_10038525
262 Ga0265316_10015669
263 Ga0265316_10028300
264 Ga0265316_10046843
265 Ga0265316_10142348
266 Ga0265313_10004913
267 Ga0265313_10005517
268 Ga0265313_10042627
269 Ga0265314_10000020
270 Ga0265314_10025452
271 Ga0316583_10023307
272 Ga0373928_0000345
273 Ga0373944_0000343
274 Ga0373932_0000002
275 Ga0373962_0000211
276 Ga0373931_0000012
277 Ga0373927_0008407
278 Ga0373937_0202952
279 Ga0373925_0000065
280 Ga0373925_0011241
281 Ga0373925_0054824
282 Ga0451577_0012735
283 Ga0453684_0025165
284 Ga0453684_0048356
285 Ga0453684_0070168
286 Ga0451576_0007509
287 Ga0451576_0117947
288 Ga0451576_0164103
289 Ga0495629_0095887
290 Ga0495651_0162418
291 Ga0495582_0010040
292 Ga0495618_0003933
293 Ga0495618_0040580
294 Ga0495630_0000119
295 Ga0495630_0109242
296 Ga0495630_0123487
297 Ga0495630_0154094
298 Ga0495666_0010318
299 Ga0495666_0055944
300 Ga0495586_0000520
301 Ga0495586_0024789
302 Ga0495586_0033351
303 Ga0495622_0021283
304 Ga0495634_0006980
305 Ga0495634_0013203
306 Ga0495635_0031041
307 Ga0495647_0013632
308 Ga0495658_0011619
309 Ga0495613_0012109
310 Ga0495613_0106029
311 Ga0495624_0042070
312 Ga0495581_0032007
313 Ga0495674_0000192
314 Ga0495676_0000717
315 Ga0495680_0069131
316 Ga0495675_0062291
317 Ga0495675_0148933
318 Ga0501031_0000229
319 Ga0501031_0183830
320 Ga0501033_0010294
321 Ga0501033_0038458
322 Ga0501033_0075487
323 Ga0501036_0108544
324 Ga0501037_0153475
325 Ga0501039_0197228
326 Ga0501043_0055796
327 Ga0501047_0083344
328 Ga0501035_0023523
329 Ga0501044_0000811
330 Ga0501044_0268412
331 nmdc:mga08x19_226771_c1
332 Ga0500650_0011413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17785

PUA_3

PUA-like domain

35

98

0.98

PF13847

Methyltransf_31

Methyltransferase domain

266

423

0.81

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

188

403

0.8

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

255

379

0.75

PF05175

MTS

Methyltransferase small domain

259

422

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dmg-assembly1.cif.gz_B thermus thermophilus m5c1942 methyltransferase rlmo 0.9425 1 400
2cww-assembly1.cif.gz_A-2 crystal structure of thermus thermophilus ttha1280, a putative sam-dependent rna methyltransferase, in complex with s-adenosyl-l-homocysteine 0.9404 6 399
2cww-assembly1.cif.gz_A-2 crystal structure of thermus thermophilus ttha1280, a putative sam-dependent rna methyltransferase, in complex with s-adenosyl-l-homocysteine 0.9356 6 399
4dmg-assembly1.cif.gz_B thermus thermophilus m5c1942 methyltransferase rlmo 0.9354 1 400
1wxw-assembly1.cif.gz_A crystal structure of tt1595, a putative sam-dependent methyltransferase from thermus thermophillus hb8 0.9303 6 399
ID Description Score Start End Superfamily
af_I1KW47_39_110_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9754 4 71 2.30.130.10
3c0kB01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9682 6 71 2.30.130.10
af_Q8IKX0_132_231_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9614 74 172 3.30.750.80
af_Q8I4W7_220_326_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9467 99 179 3.30.750.80
af_Q8IKX0_444_586_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9463 298 397 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C5QEA7-F1-model_v4 Class I SAM-dependent rRNA methyltransferase 0.9796 4 399 GO:0003723
GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A1F5RHP5-F1-model_v4 Uncharacterized protein 0.9791 4 398 GO:0003723
GO:0005737
GO:0008168
GO:0032259
AF-A0A7C5QEA7-F1-model_v4 Class I SAM-dependent rRNA methyltransferase 0.9771 4 399 GO:0003723
GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A2V5SVP9-F1-model_v4 rRNA large subunit methyltransferase I 0.9757 296 399 GO:0005737
GO:0008168
GO:0032259
AF-A0A1F5RHP5-F1-model_v4 Uncharacterized protein 0.9742 4 398 GO:0003723
GO:0005737
GO:0008168
GO:0032259

Map