F249059

General Info

Members Datasets Scaffolds Average Seq Length
166 135 332 429

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0036030|Ga0495637_0036030_279_1745
Length 488
Sequence MLPPECWDICLSPFPNRPVVRRHCFQHGLDVVAQGADDARTTARSDRTSDEGNRVVKRPWLIGGAAIVVIGLLGMVGLGWRTAIAPVARPAVASFAPAQIARGQVLAGAGYCATCHTAKGGAVLAGGYAMKTPFGTIYSTNITPDPETGIGTWSLPAFRRAMHEGVARDGSHLFPAFPYDHFTRLTDGDVADLYAFLMTRPAVKAAPKSNTVPFPLNLRLLQAGWKLLYFKPGRFTPDAGKDAMWNRGAYLVEGISHCGACHTSRGALGAENKEKAYAGALVDHWIAPPLTAANPSPVQWSADELVAYLGTGISRYHGVAAGPMGPVSHGLSKLPPTDLKAIAVYLTSFNGAAGKSAAGAPAIQQALAADRIGTGLQYDAAARLYTAACASCHYNSGKEPNSLRPELALNSAVNMDDPRNLIRVILYGVDAADGIPGVVMPGFARGFSNADVGRIADYLRATRTTKAAWPDLETKVAAIRAEGRGQEQ

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
120 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
121 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
128 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
132 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
135 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.87
Nodule 0
Rhizoplane 3.01
Rhizosphere 72.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0036030 3300046520 Bacteria 2158
2 JGI25406J46586_10007351 3300003203 Bacteria 5031
3 Ga0055531_10000534 3300003794 Bacteria 33773
4 Ga0070658_10079863 3300005327 Bacteria 2686
5 Ga0070676_10003619 3300005328 Bacteria 8078
6 Ga0070670_100003580 3300005331 Bacteria 12928
7 Ga0068869_100004711 3300005334 Bacteria 8512
8 Ga0070680_100005571 3300005336 Bacteria 9533
9 Ga0068868_100169118 3300005338 Bacteria 1809
10 Ga0070668_100011508 3300005347 Bacteria 6589
11 Ga0070669_100008506 3300005353 Bacteria 7326
12 Ga0070673_100004734 3300005364 Bacteria 8643
13 Ga0070667_100010268 3300005367 Bacteria 7736
14 Ga0070681_10049275 3300005458 Bacteria 4208
15 Ga0068867_100011240 3300005459 Bacteria 6314
16 Ga0070706_100074078 3300005467 Bacteria 3152
17 Ga0070706_100147995 3300005467 Bacteria 2192
18 Ga0070698_100099656 3300005471 Bacteria 2879
19 Ga0070679_100027518 3300005530 Bacteria 5597
20 Ga0070697_100002507 3300005536 Bacteria 14119
21 Ga0070704_100098641 3300005549 Bacteria 2196
22 Ga0068855_100148786 3300005563 Bacteria 2663
23 Ga0068855_100180761 3300005563 Bacteria 2385
24 Ga0068857_100005948 3300005577 Bacteria 10419
25 Ga0068864_100001539 3300005618 Bacteria 18988
26 Ga0068863_100007419 3300005841 Bacteria 10732
27 Ga0068858_100012334 3300005842 Bacteria 8058
28 Ga0068860_100025433 3300005843 Bacteria 5711
29 Ga0068862_100010412 3300005844 Bacteria 7677
30 Ga0081455_10000572 3300005937 Bacteria 47971
31 Ga0081540_1003482 3300005983 Bacteria 12421
32 Ga0081539_10000058 3300005985 Bacteria 256212
33 Ga0075364_10084876 3300006051 Bacteria 2097
34 Ga0075428_100008477 3300006844 Bacteria 11405
35 Ga0075430_100007520 3300006846 Bacteria 9197
36 Ga0075431_100006681 3300006847 Bacteria 11457
37 Ga0075431_100057422 3300006847 Bacteria 4014
38 Ga0075433_10019658 3300006852 Bacteria 5632
39 Ga0075434_100007698 3300006871 Bacteria 9972
40 Ga0075429_100004977 3300006880 Bacteria 11447
41 Ga0075429_100065686 3300006880 Bacteria 3159
42 Ga0075436_100103701 3300006914 Bacteria 1982
43 Ga0075436_100157545 3300006914 Bacteria 1600
44 Ga0075435_100129959 3300007076 Bacteria 2107
45 Ga0105240_10007658 3300009093 Bacteria 15633
46 Ga0105240_10089574 3300009093 Bacteria 3763
47 Ga0111539_10009589 3300009094 Bacteria 12220
48 Ga0114129_10051045 3300009147 Bacteria 5808
49 Ga0105248_10003518 3300009177 Bacteria 17377
50 Ga0105238_10060374 3300009551 Bacteria 3796
51 Ga0105239_10115785 3300010375 Bacteria 2974
52 Ga0157369_10004521 3300013105 Bacteria 16369
53 Ga0163162_10044837 3300013306 Bacteria 4430
54 Ga0163162_10055474 3300013306 Bacteria 3989
55 Ga0157372_10208582 3300013307 Bacteria 2264
56 Ga0157379_10002996 3300014968 Bacteria 14245
57 Ga0213871_10000806 3300021441 Bacteria 4681
58 Ga0209564_1000283 3300025295 Bacteria 102740
59 Ga0209051_1000214 3300025303 Bacteria 98444
60 Ga0209257_1000015 3300025304 Bacteria 908141
61 Ga0207705_10088173 3300025909 Bacteria 2269
62 Ga0207684_10222818 3300025910 Bacteria 1627
63 Ga0207707_10090631 3300025912 Bacteria 2672
64 Ga0207695_10007321 3300025913 Bacteria 14091
65 Ga0207695_10196459 3300025913 Bacteria 1933
66 Ga0207660_10146306 3300025917 Bacteria 1811
67 Ga0207652_10014389 3300025921 Bacteria 6410
68 Ga0207646_10036686 3300025922 Bacteria 4424
69 Ga0207681_10020274 3300025923 Bacteria 4209
70 Ga0207650_10011524 3300025925 Bacteria 6088
71 Ga0207689_10001319 3300025942 Bacteria 23906
72 Ga0207667_10298692 3300025949 Bacteria 1645
73 Ga0207668_10013914 3300025972 Bacteria 4969
74 Ga0207658_10010357 3300025986 Bacteria 6333
75 Ga0207677_10018444 3300026023 Bacteria 4187
76 Ga0207641_10017341 3300026088 Bacteria 5894
77 Ga0207648_10075647 3300026089 Bacteria 2935
78 Ga0207676_10008871 3300026095 Bacteria 7153
79 Ga0207674_10012764 3300026116 Bacteria 9383
80 Ga0207675_100003963 3300026118 Bacteria 14369
81 Ga0207428_10005114 3300027907 Bacteria 12304
82 Ga0207428_10054405 3300027907 Bacteria 3188
83 Ga0268264_10006444 3300028381 Bacteria 9883
84 Ga0268264_10101834 3300028381 Bacteria 2498
85 Ga0307515_10093088 3300028794 Bacteria 3742
86 Ga0265314_10037521 3300031711 Bacteria 3510
87 Ga0395900_0029893 3300037418 Bacteria 5591
88 Ga0395900_0124267 3300037418 Bacteria 2646
89 Ga0395898_0035464 3300037466 Bacteria 4959
90 Ga0395898_0198479 3300037466 Bacteria 1916
91 Ga0395905_0132588 3300037471 Bacteria 2343
92 Ga0395901_0058944 3300038443 Bacteria 3994
93 Ga0395901_0062221 3300038443 Bacteria 3884
94 Ga0436360_0931190 3300039438 Bacteria 11567
95 Ga0436361_0157085 3300039447 Bacteria 3080
96 Ga0436361_1179158 3300039447 Bacteria 4064
97 Ga0451806_598508 3300041462 Bacteria 3344
98 Ga0466972_0070272 3300044658 Bacteria 1671
99 Ga0466957_0003926 3300044842 Bacteria 8221
100 Ga0495627_000483 3300046453 Bacteria 33680
101 Ga0495650_0000185 3300046471 Bacteria 136913
102 Ga0495583_0000023 3300046506 Bacteria 280019
103 Ga0495610_0018383 3300046512 Bacteria 3951
104 Ga0495632_0018888 3300046519 Bacteria 3767
105 Ga0495648_0042589 3300046524 Bacteria 2855
106 Ga0495654_0000053 3300046530 Bacteria 145014
107 Ga0495597_0005925 3300046542 Bacteria 6381
108 Ga0495625_0000683 3300046660 Bacteria 48312
109 Ga0495625_0007535 3300046660 Bacteria 9453
110 Ga0495625_0009883 3300046660 Bacteria 7934
111 Ga0495625_0032162 3300046660 Bacteria 3895
112 Ga0495672_0000630 3300047320 Bacteria 39369
113 Ga0495673_0000377 3300047469 Bacteria 53346
114 Ga0495673_0019600 3300047469 Bacteria 3386
115 Ga0495686_0010996 3300047472 Bacteria 6402
116 Ga0495686_0015143 3300047472 Bacteria 5281
117 Ga0496102_0009107 3300048905 Bacteria 8520
118 Ga0496107_0000113 3300048910 Bacteria 39326
119 Ga0496109_0068000 3300048912 Bacteria 3265
120 Ga0496118_0093285 3300048921 Bacteria 2063
121 Ga0496119_0039236 3300048922 Bacteria 3045
122 Ga0496121_0000197 3300048924 Bacteria 135555
123 Ga0496121_0002319 3300048924 Bacteria 29484
124 Ga0496122_0011247 3300048925 Bacteria 9094
125 Ga0496122_0015369 3300048925 Bacteria 7322
126 Ga0496123_0008845 3300048926 Bacteria 9174
127 Ga0496123_0011322 3300048926 Bacteria 7747
128 Ga0496125_0016201 3300048928 Bacteria 7166
129 Ga0496126_0012486 3300048929 Bacteria 8698
130 Ga0496126_0091443 3300048929 Bacteria 2676
131 Ga0495678_002856 3300049459 Bacteria 11185
132 Ga0501083_0167707 3300049744 Bacteria 1435
133 nmdc:mga05p37_29375_c1 3300050507 Bacteria 6710
134 nmdc:mga09592_22024_c1 3300050508 Bacteria 5258
135 nmdc:mga0qj67_5781_c1 3300050509 Bacteria 9054
136 nmdc:mga06r32_19334_c1 3300050510 Bacteria 6251
137 nmdc:mga06r32_43798_c1 3300050510 Bacteria 4259
138 nmdc:mga08y16_19407_c1 3300050511 Bacteria 7168
139 nmdc:mga0n895_3572_c1 3300050512 Bacteria 10290
140 nmdc:mga0a205_5477_c1 3300050515 Bacteria 4995
141 Ga0500643_000276 3300053087 Bacteria 44463
142 Ga0500644_0002996 3300053088 Bacteria 4187
143 Ga0500651_0000882 3300053093 Bacteria 14707
144 Ga0500554_001170 3300053102 Bacteria 5087
145 Ga0500555_001650 3300053103 Bacteria 6740
146 Ga0500556_0001835 3300053104 Bacteria 7755
147 Ga0500614_002977 3300053123 Bacteria 3700
148 Ga0500618_000024 3300053125 Bacteria 152149
149 Ga0500618_006400 3300053125 Bacteria 3463
150 Ga0500655_000040 3300053133 Bacteria 35834
151 Ga0500559_0000015 3300053136 Bacteria 158494
152 Ga0500559_0000915 3300053136 Bacteria 18771
153 Ga0500559_0003697 3300053136 Bacteria 7459
154 Ga0500577_0010853 3300053142 Bacteria 2698
155 Ga0500590_000045 3300053148 Bacteria 29631
156 Ga0500616_0000002 3300053153 Bacteria 1611257
157 Ga0500616_0002141 3300053153 Bacteria 17095
158 Ga0500616_0013843 3300053153 Bacteria 4657
159 Ga0500616_0034555 3300053153 Bacteria 2753
160 Ga0500622_0017181 3300053156 Bacteria 3853
161 Ga0500627_0000020 3300053158 Bacteria 109977
162 Ga0500627_0041165 3300053158 Bacteria 1985
163 Ga0500570_000205 3300053724 Bacteria 18960
164 Ga0501082_0196920 3300060353 Bacteria 1753
165 2600201350 2599185354 Bacteria 4398675
166 2884340559 2884338543 Bacteria 4610696
167 Ga0495637_0036030
168 JGI25406J46586_10007351
169 Ga0055531_10000534
170 Ga0070658_10079863
171 Ga0070676_10003619
172 Ga0070670_100003580
173 Ga0068869_100004711
174 Ga0070680_100005571
175 Ga0068868_100169118
176 Ga0070668_100011508
177 Ga0070669_100008506
178 Ga0070673_100004734
179 Ga0070667_100010268
180 Ga0070681_10049275
181 Ga0068867_100011240
182 Ga0070706_100074078
183 Ga0070706_100147995
184 Ga0070698_100099656
185 Ga0070679_100027518
186 Ga0070697_100002507
187 Ga0070704_100098641
188 Ga0068855_100148786
189 Ga0068855_100180761
190 Ga0068857_100005948
191 Ga0068864_100001539
192 Ga0068863_100007419
193 Ga0068858_100012334
194 Ga0068860_100025433
195 Ga0068862_100010412
196 Ga0081455_10000572
197 Ga0081540_1003482
198 Ga0081539_10000058
199 Ga0075364_10084876
200 Ga0075428_100008477
201 Ga0075430_100007520
202 Ga0075431_100006681
203 Ga0075431_100057422
204 Ga0075433_10019658
205 Ga0075434_100007698
206 Ga0075429_100004977
207 Ga0075429_100065686
208 Ga0075436_100103701
209 Ga0075436_100157545
210 Ga0075435_100129959
211 Ga0105240_10007658
212 Ga0105240_10089574
213 Ga0111539_10009589
214 Ga0114129_10051045
215 Ga0105248_10003518
216 Ga0105238_10060374
217 Ga0105239_10115785
218 Ga0157369_10004521
219 Ga0163162_10044837
220 Ga0163162_10055474
221 Ga0157372_10208582
222 Ga0157379_10002996
223 Ga0213871_10000806
224 Ga0209564_1000283
225 Ga0209051_1000214
226 Ga0209257_1000015
227 Ga0207705_10088173
228 Ga0207684_10222818
229 Ga0207707_10090631
230 Ga0207695_10007321
231 Ga0207695_10196459
232 Ga0207660_10146306
233 Ga0207652_10014389
234 Ga0207646_10036686
235 Ga0207681_10020274
236 Ga0207650_10011524
237 Ga0207689_10001319
238 Ga0207667_10298692
239 Ga0207668_10013914
240 Ga0207658_10010357
241 Ga0207677_10018444
242 Ga0207641_10017341
243 Ga0207648_10075647
244 Ga0207676_10008871
245 Ga0207674_10012764
246 Ga0207675_100003963
247 Ga0207428_10005114
248 Ga0207428_10054405
249 Ga0268264_10006444
250 Ga0268264_10101834
251 Ga0307515_10093088
252 Ga0265314_10037521
253 Ga0395900_0029893
254 Ga0395900_0124267
255 Ga0395898_0035464
256 Ga0395898_0198479
257 Ga0395905_0132588
258 Ga0395901_0058944
259 Ga0395901_0062221
260 Ga0436360_0931190
261 Ga0436361_0157085
262 Ga0436361_1179158
263 Ga0451806_598508
264 Ga0466972_0070272
265 Ga0466957_0003926
266 Ga0495627_000483
267 Ga0495650_0000185
268 Ga0495583_0000023
269 Ga0495610_0018383
270 Ga0495632_0018888
271 Ga0495648_0042589
272 Ga0495654_0000053
273 Ga0495597_0005925
274 Ga0495625_0000683
275 Ga0495625_0007535
276 Ga0495625_0009883
277 Ga0495625_0032162
278 Ga0495672_0000630
279 Ga0495673_0000377
280 Ga0495673_0019600
281 Ga0495686_0010996
282 Ga0495686_0015143
283 Ga0496102_0009107
284 Ga0496107_0000113
285 Ga0496109_0068000
286 Ga0496118_0093285
287 Ga0496119_0039236
288 Ga0496121_0000197
289 Ga0496121_0002319
290 Ga0496122_0011247
291 Ga0496122_0015369
292 Ga0496123_0008845
293 Ga0496123_0011322
294 Ga0496125_0016201
295 Ga0496126_0012486
296 Ga0496126_0091443
297 Ga0495678_002856
298 Ga0501083_0167707
299 nmdc:mga05p37_29375_c1
300 nmdc:mga09592_22024_c1
301 nmdc:mga0qj67_5781_c1
302 nmdc:mga06r32_19334_c1
303 nmdc:mga06r32_43798_c1
304 nmdc:mga08y16_19407_c1
305 nmdc:mga0n895_3572_c1
306 nmdc:mga0a205_5477_c1
307 Ga0500643_000276
308 Ga0500644_0002996
309 Ga0500651_0000882
310 Ga0500554_001170
311 Ga0500555_001650
312 Ga0500556_0001835
313 Ga0500614_002977
314 Ga0500618_000024
315 Ga0500618_006400
316 Ga0500655_000040
317 Ga0500559_0000015
318 Ga0500559_0000915
319 Ga0500559_0003697
320 Ga0500577_0010853
321 Ga0500590_000045
322 Ga0500616_0000002
323 Ga0500616_0002141
324 Ga0500616_0013843
325 Ga0500616_0034555
326 Ga0500622_0017181
327 Ga0500627_0000020
328 Ga0500627_0041165
329 Ga0500570_000205
330 Ga0501082_0196920
331 2600201350
332 2884340559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

100

201

0.91

PF00034

Cytochrom_C

Cytochrome c

378

463

0.91

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

376

459

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8786 17 417
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.8677 31 408
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8552 38 407
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8441 17 417
7w2j-assembly1.cif.gz_C cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8415 38 407
ID Description Score Start End Superfamily
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.737 307 389 1.10.760.10
2zooA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6983 303 406 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6907 307 389 1.10.760.10
2v08B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6484 306 386 1.10.760.10
5oboA03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.648 306 407 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A0S6TFV2-F1-model_v4 deleted 0.962 17 267
AF-A0A149TDS9-F1-model_v4 deleted 0.9616 17 285
AF-A0A2R7SEB7-F1-model_v4 Aldehyde dehydrogenase 0.9612 14 281 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A2R7JB24-F1-model_v4 Aldehyde dehydrogenase 0.9598 14 285 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A4U0YPL3-F1-model_v4 Cytochrome c 0.9583 14 294 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037

Map