F249338

General Info

Members Datasets Scaffolds Average Seq Length
166 139 332 207

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_328326_c1|nmdc:mga0k408_328326_c1_235_900
Length 221
Sequence MQITMRTTFDAKTNMNQKWDERYKDHEFAYGKDPNLFFNEWLPKFEPGSILMPADGEGRNGVFAAQLGWRVTSFDLSIEGQTKALQLAKENGVALEYIVGDLEQLSFARETFNAIGLVYAHFSAVKKSIFHRKLNDYLLPGGIIILEAFSKRHINFVQLDPKVGGPKDIDMLYSKEEIISDFENYEVLLLEEEEILLNEGKYHNGKGSVIRFIGRKAGRDN

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
110 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
111 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
114 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
115 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
117 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
118 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
123 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
126 2738541283 Pedobacter sp. OK701 Isolate Unclassified
127 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
128 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
129 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
130 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
131 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
132 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
133 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
134 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
135 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
136 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
137 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
138 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
139 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.96
Metatranscriptomes 0
Isolates 9.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.48
Nodule 0
Rhizoplane 0
Rhizosphere 60.24
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_328326_c1 3300050493 Bacteria 913
2 rootH2_10052059 3300003320 Bacteria 1895
3 rootH2_10214163 3300003320 Bacteria 2965
4 rootL2_10011536 3300003322 Bacteria 7296
5 rootL2_10040595 3300003322 Bacteria 6527
6 rootL2_10077340 3300003322 Bacteria 4202
7 rootH1_10085833 3300003323 Bacteria 12771
8 JGI25160J50197_1013995 3300003354 Bacteria 2705
9 Ga0055535_1003848 3300003761 Bacteria 3966
10 Ga0065165_1002384 3300005262 Bacteria 16148
11 Ga0065165_1023845 3300005262 Bacteria 2066
12 Ga0065714_10077794 3300005288 Bacteria 2657
13 Ga0070683_100046568 3300005329 Bacteria 4007
14 Ga0070670_100046857 3300005331 Bacteria 3719
15 Ga0070679_100053509 3300005530 Unclassified 4018
16 Ga0070684_100303631 3300005535 Bacteria 1465
17 Ga0068853_100030061 3300005539 Bacteria 4586
18 Ga0068853_100131249 3300005539 Bacteria 2243
19 Ga0068853_100412714 3300005539 Bacteria 1265
20 Ga0070665_100000181 3300005548 Bacteria 112127
21 Ga0070665_100005211 3300005548 Bacteria 13450
22 Ga0070665_100362657 3300005548 Bacteria 1455
23 Ga0068859_100069173 3300005617 Unclassified 3565
24 Ga0068860_100014042 3300005843 Bacteria 7856
25 Ga0068862_100039406 3300005844 Unclassified 4013
26 Ga0075366_10310694 3300006195 Bacteria 965
27 Ga0097621_100548273 3300006237 Bacteria 1052
28 Ga0075370_10236141 3300006353 Bacteria 1082
29 Ga0097620_100069174 3300006931 Unclassified 3565
30 Ga0105244_10000002 3300009036 Bacteria 495554
31 Ga0114129_10007582 3300009147 Bacteria 15450
32 Ga0105241_10062044 3300009174 Unclassified 2880
33 Ga0105237_10007266 3300009545 Bacteria 12154
34 Ga0105237_10091499 3300009545 Bacteria 3031
35 Ga0105239_10200297 3300010375 Bacteria 2237
36 Ga0157370_10000483 3300013104 Bacteria 49618
37 Ga0157374_10162859 3300013296 Bacteria 2173
38 Ga0157374_10266270 3300013296 Bacteria 1689
39 Ga0163162_10008511 3300013306 Bacteria 10005
40 Ga0157372_10710849 3300013307 Bacteria 1169
41 Ga0157375_10040778 3300013308 Bacteria 4478
42 Ga0157375_10094600 3300013308 Bacteria 3057
43 Ga0163163_10210375 3300014325 Unclassified 1994
44 Ga0182008_10039465 3300014497 Bacteria 2359
45 Ga0182006_1000643 3300015261 Bacteria 24749
46 Ga0182005_1000419 3300015265 Bacteria 22951
47 Ga0163161_10006365 3300017792 Bacteria 8172
48 Ga0209436_100969 3300025208 Bacteria 11188
49 Ga0209436_102293 3300025208 Bacteria 5873
50 Ga0209258_100036 3300025242 Bacteria 428859
51 Ga0209148_1000139 3300025254 Bacteria 167011
52 Ga0209130_1001912 3300025284 Bacteria 11729
53 Ga0207426_1000288 3300025302 Bacteria 100477
54 Ga0207426_1016238 3300025302 Bacteria 2678
55 Ga0207655_1000012 3300025728 Bacteria 640488
56 Ga0207695_10019958 3300025913 Bacteria 7696
57 Ga0207671_10036945 3300025914 Bacteria 3622
58 Ga0207652_10040282 3300025921 Unclassified 3967
59 Ga0207640_10071090 3300025981 Bacteria 2343
60 Ga0207677_10445695 3300026023 Bacteria 1108
61 Ga0207639_10015016 3300026041 Bacteria 5455
62 Ga0207676_10110254 3300026095 Bacteria 2302
63 Ga0207676_10697293 3300026095 Bacteria 983
64 Ga0207674_10198357 3300026116 Bacteria 1956
65 Ga0268266_10000166 3300028379 Bacteria 120201
66 Ga0268266_10004733 3300028379 Bacteria 12937
67 Ga0268265_10030022 3300028380 Unclassified 3911
68 Ga0268264_10061175 3300028381 Bacteria 3158
69 Ga0307515_10000135 3300028794 Bacteria 175323
70 Ga0307515_10189641 3300028794 Bacteria 1971
71 Ga0316179_1098529 3300030734 Bacteria 4246
72 Ga0307513_10302610 3300031456 Bacteria 1365
73 Ga0307509_10067153 3300031507 Bacteria 3758
74 Ga0307408_100001580 3300031548 Bacteria 16814
75 Ga0307508_10001251 3300031616 Bacteria 29009
76 Ga0307514_10065754 3300031649 Unclassified 2745
77 Ga0307516_10150023 3300031730 Bacteria 2093
78 Ga0307413_10000085 3300031824 Bacteria 23303
79 Ga0307410_10013903 3300031852 Bacteria 4714
80 Ga0307406_10000042 3300031901 Bacteria 72211
81 Ga0307407_10004183 3300031903 Bacteria 6083
82 Ga0307412_10000007 3300031911 Bacteria 486267
83 Ga0307412_10005869 3300031911 Bacteria 6915
84 Ga0307414_10000022 3300032004 Bacteria 212123
85 Ga0307414_10000264 3300032004 Bacteria 32949
86 Ga0307411_10226061 3300032005 Bacteria 1455
87 Ga0316583_10012057 3300032133 Bacteria 3118
88 Ga0373931_0076666 3300035691 Bacteria 1837
89 Ga0373931_0104441 3300035691 Bacteria 1598
90 Ga0439466_0000804 3300041411 Bacteria 11943
91 Ga0451849_0601757 3300041505 Bacteria 863
92 Ga0451853_0887640 3300041512 Bacteria 773
93 Ga0451577_0685920 3300042876 Unclassified 928
94 Ga0453683_0008606 3300044673 Bacteria 6843
95 Ga0453684_0099500 3300044712 Bacteria 3562
96 Ga0466957_0007111 3300044842 Bacteria 6330
97 Ga0466957_0039239 3300044842 Bacteria 2856
98 Ga0451576_1381182 3300045051 Unclassified 733
99 Ga0495638_0093865 3300046460 Bacteria 1804
100 Ga0495643_0018439 3300046522 Bacteria 4055
101 Ga0495648_0068536 3300046524 Bacteria 2069
102 Ga0495668_0000112 3300046616 Bacteria 128501
103 Ga0495668_0000631 3300046616 Bacteria 42400
104 Ga0495668_0008849 3300046616 Bacteria 6238
105 Ga0495625_0174107 3300046660 Bacteria 1435
106 Ga0495661_0000996 3300046665 Bacteria 25550
107 Ga0495636_0000141 3300047318 Bacteria 29117
108 Ga0495687_042335 3300047443 Unclassified 1990
109 Ga0495614_0022410 3300048089 Bacteria 2726
110 Ga0496121_0000008 3300048924 Bacteria 843593
111 Ga0496122_0021885 3300048925 Bacteria 5703
112 Ga0496122_0054899 3300048925 Unclassified 2986
113 Ga0496123_0004827 3300048926 Bacteria 13903
114 Ga0496123_0165517 3300048926 Bacteria 1173
115 Ga0496125_0080464 3300048928 Unclassified 2493
116 Ga0501292_013872 3300049515 Unclassified 1244
117 Ga0501034_0003996 3300049571 Bacteria 16563
118 Ga0501043_0118019 3300049579 Unclassified 2081
119 Ga0501046_0005822 3300049580 Bacteria 10993
120 Ga0501047_0030381 3300049581 Bacteria 5209
121 Ga0501048_0111885 3300049582 Unclassified 1928
122 Ga0501070_0734200 3300049586 Unclassified 779
123 Ga0501073_0106697 3300049589 Unclassified 1943
124 Ga0501074_0064890 3300049590 Bacteria 2628
125 Ga0501238_000334 3300049671 Bacteria 6113
126 Ga0501249_000003 3300049679 Bacteria 242930
127 Ga0501079_0934162 3300049741 Unclassified 683
128 Ga0501080_0157406 3300049742 Unclassified 2098
129 Ga0501280_001301 3300049776 Bacteria 4778
130 Ga0501035_0022765 3300049822 Bacteria 5755
131 nmdc:mga0k408_146095_c1 3300050493 Bacteria 1408
132 nmdc:mga0k408_306041_c1 3300050493 Bacteria 948
133 nmdc:mga07m45_228673_c1 3300050496 Bacteria 1082
134 nmdc:mga05p37_43102_c1 3300050507 Bacteria 5549
135 Ga0500646_0035901 3300053090 Bacteria 1380
136 Ga0500583_0001422 3300053092 Bacteria 6860
137 Ga0500556_0173716 3300053104 Unclassified 851
138 Ga0500562_000148 3300053108 Bacteria 20782
139 Ga0500569_002524 3300053109 Unclassified 3621
140 Ga0500594_0028286 3300053118 Bacteria 1458
141 Ga0500594_0086767 3300053118 Bacteria 944
142 Ga0500658_0028665 3300053134 Unclassified 2162
143 Ga0500559_0014881 3300053136 Bacteria 3287
144 Ga0500568_0034798 3300053139 Bacteria 2059
145 Ga0500590_227432 3300053148 Bacteria 763
146 Ga0500604_0001966 3300053151 Bacteria 5706
147 Ga0500616_0059540 3300053153 Bacteria 1983
148 Ga0500622_0003572 3300053156 Bacteria 10268
149 Ga0500636_0137087 3300053177 Bacteria 1358
150 Ga0500584_030186 3300053726 Bacteria 2515
151 Ga0500645_037228 3300053730 Bacteria 1445
152 2644373462 2643221667 Bacteria 5627472
153 2738758521 2738541283 Bacteria 7222293
154 2819576934 2818991442 Bacteria 8318214
155 2821142859 2821136567 Bacteria 8080116
156 2857617691 2857613821 Bacteria 4917088
157 2884795899 2884791551 Bacteria 8511252
158 2896111570 2896109856 Bacteria 7140722
159 2904473739 2904467357 Bacteria 8057758
160 2904557859 2904555929 Bacteria 5218588
161 2929154408 2929150217 Bacteria 5462483
162 2929157105 2929154850 Bacteria 6753285
163 2929180411 2929177148 Bacteria 7883697
164 2929245132 2929239360 Bacteria 7745570
165 2945982804 2945977869 Bacteria 7777518
166 2946017803 2946013367 Bacteria 7766675
167 nmdc:mga0k408_328326_c1
168 rootH2_10052059
169 rootH2_10214163
170 rootL2_10011536
171 rootL2_10040595
172 rootL2_10077340
173 rootH1_10085833
174 JGI25160J50197_1013995
175 Ga0055535_1003848
176 Ga0065165_1002384
177 Ga0065165_1023845
178 Ga0065714_10077794
179 Ga0070683_100046568
180 Ga0070670_100046857
181 Ga0070679_100053509
182 Ga0070684_100303631
183 Ga0068853_100030061
184 Ga0068853_100131249
185 Ga0068853_100412714
186 Ga0070665_100000181
187 Ga0070665_100005211
188 Ga0070665_100362657
189 Ga0068859_100069173
190 Ga0068860_100014042
191 Ga0068862_100039406
192 Ga0075366_10310694
193 Ga0097621_100548273
194 Ga0075370_10236141
195 Ga0097620_100069174
196 Ga0105244_10000002
197 Ga0114129_10007582
198 Ga0105241_10062044
199 Ga0105237_10007266
200 Ga0105237_10091499
201 Ga0105239_10200297
202 Ga0157370_10000483
203 Ga0157374_10162859
204 Ga0157374_10266270
205 Ga0163162_10008511
206 Ga0157372_10710849
207 Ga0157375_10040778
208 Ga0157375_10094600
209 Ga0163163_10210375
210 Ga0182008_10039465
211 Ga0182006_1000643
212 Ga0182005_1000419
213 Ga0163161_10006365
214 Ga0209436_100969
215 Ga0209436_102293
216 Ga0209258_100036
217 Ga0209148_1000139
218 Ga0209130_1001912
219 Ga0207426_1000288
220 Ga0207426_1016238
221 Ga0207655_1000012
222 Ga0207695_10019958
223 Ga0207671_10036945
224 Ga0207652_10040282
225 Ga0207640_10071090
226 Ga0207677_10445695
227 Ga0207639_10015016
228 Ga0207676_10110254
229 Ga0207676_10697293
230 Ga0207674_10198357
231 Ga0268266_10000166
232 Ga0268266_10004733
233 Ga0268265_10030022
234 Ga0268264_10061175
235 Ga0307515_10000135
236 Ga0307515_10189641
237 Ga0316179_1098529
238 Ga0307513_10302610
239 Ga0307509_10067153
240 Ga0307408_100001580
241 Ga0307508_10001251
242 Ga0307514_10065754
243 Ga0307516_10150023
244 Ga0307413_10000085
245 Ga0307410_10013903
246 Ga0307406_10000042
247 Ga0307407_10004183
248 Ga0307412_10000007
249 Ga0307412_10005869
250 Ga0307414_10000022
251 Ga0307414_10000264
252 Ga0307411_10226061
253 Ga0316583_10012057
254 Ga0373931_0076666
255 Ga0373931_0104441
256 Ga0439466_0000804
257 Ga0451849_0601757
258 Ga0451853_0887640
259 Ga0451577_0685920
260 Ga0453683_0008606
261 Ga0453684_0099500
262 Ga0466957_0007111
263 Ga0466957_0039239
264 Ga0451576_1381182
265 Ga0495638_0093865
266 Ga0495643_0018439
267 Ga0495648_0068536
268 Ga0495668_0000112
269 Ga0495668_0000631
270 Ga0495668_0008849
271 Ga0495625_0174107
272 Ga0495661_0000996
273 Ga0495636_0000141
274 Ga0495687_042335
275 Ga0495614_0022410
276 Ga0496121_0000008
277 Ga0496122_0021885
278 Ga0496122_0054899
279 Ga0496123_0004827
280 Ga0496123_0165517
281 Ga0496125_0080464
282 Ga0501292_013872
283 Ga0501034_0003996
284 Ga0501043_0118019
285 Ga0501046_0005822
286 Ga0501047_0030381
287 Ga0501048_0111885
288 Ga0501070_0734200
289 Ga0501073_0106697
290 Ga0501074_0064890
291 Ga0501238_000334
292 Ga0501249_000003
293 Ga0501079_0934162
294 Ga0501080_0157406
295 Ga0501280_001301
296 Ga0501035_0022765
297 nmdc:mga0k408_146095_c1
298 nmdc:mga0k408_306041_c1
299 nmdc:mga07m45_228673_c1
300 nmdc:mga05p37_43102_c1
301 Ga0500646_0035901
302 Ga0500583_0001422
303 Ga0500556_0173716
304 Ga0500562_000148
305 Ga0500569_002524
306 Ga0500594_0028286
307 Ga0500594_0086767
308 Ga0500658_0028665
309 Ga0500559_0014881
310 Ga0500568_0034798
311 Ga0500590_227432
312 Ga0500604_0001966
313 Ga0500616_0059540
314 Ga0500622_0003572
315 Ga0500636_0137087
316 Ga0500584_030186
317 Ga0500645_037228
318 2644373462
319 2738758521
320 2819576934
321 2821142859
322 2857617691
323 2884795899
324 2896111570
325 2904473739
326 2904557859
327 2929154408
328 2929157105
329 2929180411
330 2929245132
331 2945982804
332 2946017803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

51

146

0.93

PF13649

Methyltransf_25

Methyltransferase domain

50

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8934 19 204
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8836 19 204
3m70-assembly1.cif.gz_A crystal structure of tehb from haemophilus influenzae 0.8345 20 202
2p8j-assembly1.cif.gz_A crystal structure of s-adenosylmethionine-dependent methyltransferase (np_349143.1) from clostridium acetobutylicum at 2.00 a resolution 0.8209 20 204
4dq0-assembly4.cif.gz_D the crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai 0.8203 21 202
ID Description Score Start End Superfamily
af_A0A1D6MWB7_118_238_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 35 88 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9305 35 90 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9113 34 90 3.40.50.150
3merB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8934 19 204 3.40.50.150
af_Q4CXS4_6_191_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8918 23 104 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G4A4T7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9844 34 101 GO:0008757
GO:0032259
AF-A0A5Q4E4J2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9833 1 202 GO:0008168
GO:0032259
AF-L1NS32-F1-model_v4 Methyltransferase domain protein 0.9799 2 204 GO:0008168
GO:0032259
AF-A0A1L6R4K3-F1-model_v4 Methyltransferase 0.9779 1 204 GO:0008168
GO:0032259
AF-A0A0K2V269-F1-model_v4 Methyltransferase domain-containing protein 0.9774 5 202

Map