F249451

General Info

Members Datasets Scaffolds Average Seq Length
166 130 334 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2886848708|2886854228
Length 345
Sequence TSMTMSLSTTPRSRSCATALATLALCAPLMALAATAPAQPPKPAKPSRSSADILATAPASVWRDVDPDNLLVMTLPQGQVFIELAPRFAPAHVDNIRALARGGYYDGLAIVRVQDNFVTQWGDPNADDEDTGMKGKGKPFPAGAKAHLPAEFSIPLKGVPMTVLPDVDGWAPRVGQVDGFAAAADPKAGKAWLAHCYGSVGAGRGNAADSSTGAELYAVIGQAPRGLDLNITVVGRVLKGMEFLSSLPRGGAAMGFYDKPEQRLGIERVALAAALPAEQRPALQVLRTDTPTWQELLDARRHRGGWFVHSPGYTDLCSAAVPVRVKPAAGPEVKLNEPKSPESRR

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
83 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
111 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
114 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
115 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
126 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
127 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
128 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
129 2831864461 Roseateles noduli HZ7 Isolate Nodule
130 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.13
Nodule 1.81
Rhizoplane 0
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000222 3300002705 Bacteria 39568
2 JGI25156J39149_1000835 3300002705 Bacteria 15565
3 JGI25157J39369_1000056 3300002741 Bacteria 107681
4 JGI25157J39369_1000100 3300002741 Bacteria 73363
5 JGI25406J46586_10025669 3300003203 Bacteria 2284
6 rootH1_10001028 3300003316 Bacteria 11892
7 rootH1_10021924 3300003316 Bacteria 2643
8 rootL2_10001519 3300003322 Bacteria 91967
9 rootL2_10086213 3300003322 Bacteria 2507
10 rootH1_10013770 3300003316 Bacteria 3901
11 rootH1_10013770 3300003323 Bacteria 5331
12 rootH1_10013771 3300003316 Bacteria 3106
13 rootH1_10013771 3300003323 Bacteria 14908
14 rootH1_10054607 3300003323 Bacteria 4086
15 rootH1_10187076 3300003323 Bacteria 4759
16 rootH1_10402802 3300003323 Bacteria 1605
17 Ga0055539_1000400 3300003752 Bacteria 16967
18 Ga0055539_1002889 3300003752 Bacteria 2506
19 Ga0055533_1000080 3300003756 Bacteria 131291
20 Ga0055525_1001331 3300003759 Bacteria 4884
21 Ga0055535_1000198 3300003761 Bacteria 63889
22 Ga0055529_1000911 3300003763 Bacteria 16150
23 Ga0055526_1001599 3300003771 Bacteria 15892
24 Ga0055524_1001433 3300003775 Bacteria 13696
25 Ga0055531_10002486 3300003794 Bacteria 12290
26 Ga0055531_10006204 3300003794 Bacteria 6825
27 Ga0055531_10008645 3300003794 Bacteria 5329
28 Ga0065165_1000411 3300005262 Bacteria 68430
29 Ga0065165_1000678 3300005262 Bacteria 49056
30 Ga0070658_10025275 3300005327 Bacteria 4762
31 Ga0070658_10405127 3300005327 Bacteria 1172
32 Ga0070683_100173965 3300005329 Bacteria 2044
33 Ga0070690_100017473 3300005330 Bacteria 4314
34 Ga0070682_100168179 3300005337 Bacteria 1521
35 Ga0070660_100069284 3300005339 Bacteria 2750
36 Ga0068855_100004750 3300005563 Bacteria 16587
37 Ga0068857_100001183 3300005577 Bacteria 20375
38 Ga0068854_100011407 3300005578 Bacteria 5784
39 Ga0068856_100000722 3300005614 Bacteria 35876
40 Ga0068859_100166944 3300005617 Bacteria 2281
41 Ga0068859_100220955 3300005617 Bacteria 1982
42 Ga0068864_100225463 3300005618 Bacteria 1731
43 Ga0068861_100054241 3300005719 Bacteria 3053
44 Ga0068863_100271160 3300005841 Bacteria 1643
45 Ga0068862_100274169 3300005844 Bacteria 1544
46 Ga0081539_10000007 3300005985 Bacteria 532790
47 Ga0075366_10023262 3300006195 Bacteria 3609
48 Ga0075366_10086902 3300006195 Bacteria 1871
49 Ga0075370_10005976 3300006353 Bacteria 6092
50 Ga0075370_10007965 3300006353 Bacteria 5429
51 Ga0075370_10012173 3300006353 Bacteria 4539
52 Ga0097620_100166945 3300006931 Bacteria 2281
53 Ga0097620_100220965 3300006931 Bacteria 1982
54 Ga0099823_1001509 3300006944 Bacteria 19439
55 Ga0105241_10458162 3300009174 Bacteria 1129
56 Ga0105237_10042201 3300009545 Bacteria 4601
57 Ga0105238_10050906 3300009551 Bacteria 4168
58 Ga0105249_10067641 3300009553 Bacteria 3292
59 Ga0105239_10019812 3300010375 Bacteria 7424
60 Ga0105239_10043391 3300010375 Bacteria 4929
61 Ga0157319_1000001 3300012497 Bacteria 423237
62 Ga0157378_10082653 3300013297 Bacteria 2905
63 Ga0157376_10364515 3300014969 Bacteria 1387
64 Ga0213872_10001185 3300021361 Bacteria 17711
65 Ga0213872_10002829 3300021361 Bacteria 9921
66 Ga0209674_100003 3300025226 Bacteria 2196646
67 Ga0209563_100049 3300025230 Bacteria 358472
68 Ga0207427_101398 3300025231 Bacteria 8819
69 Ga0209258_100189 3300025242 Bacteria 128268
70 Ga0209258_101303 3300025242 Bacteria 9247
71 Ga0209646_1000124 3300025246 Bacteria 138207
72 Ga0209026_1000085 3300025250 Bacteria 185778
73 Ga0209677_100135 3300025253 Bacteria 69251
74 Ga0209677_100203 3300025253 Bacteria 47561
75 Ga0209759_1000068 3300025256 Bacteria 183479
76 Ga0209759_1000657 3300025256 Bacteria 32051
77 Ga0209759_1001691 3300025256 Bacteria 11476
78 Ga0209759_1005098 3300025256 Bacteria 4690
79 Ga0209759_1022373 3300025256 Bacteria 1414
80 Ga0209455_1000092 3300025272 Bacteria 220516
81 Ga0209673_1004856 3300025273 Bacteria 7023
82 Ga0209564_1000005 3300025295 Bacteria 1147192
83 Ga0209758_1000167 3300025297 Bacteria 151074
84 Ga0209050_1003666 3300025298 Bacteria 11084
85 Ga0209256_1002220 3300025299 Bacteria 16591
86 Ga0209256_1002624 3300025299 Bacteria 14196
87 Ga0209051_1002002 3300025303 Bacteria 15550
88 Ga0209051_1006130 3300025303 Bacteria 6835
89 Ga0209257_1002900 3300025304 Bacteria 15886
90 Ga0209257_1003449 3300025304 Bacteria 13551
91 Ga0207671_10152979 3300025914 Bacteria 1783
92 Ga0207657_10015862 3300025919 Bacteria 7280
93 Ga0207700_10277742 3300025928 Bacteria 1440
94 Ga0207670_10170176 3300025936 Bacteria 1633
95 Ga0207667_10002685 3300025949 Bacteria 22003
96 Ga0207640_10004602 3300025981 Bacteria 7486
97 Ga0207639_10046603 3300026041 Bacteria 3272
98 Ga0207674_10003076 3300026116 Bacteria 20639
99 Ga0207675_100110690 3300026118 Bacteria 2591
100 Ga0209389_1010744 3300027296 Bacteria 8266
101 Ga0209371_1019515 3300027312 Bacteria 1689
102 Ga0268265_10246738 3300028380 Bacteria 1579
103 Ga0265336_10000006 3300028666 Bacteria 348453
104 Ga0307517_10129087 3300028786 Bacteria 1829
105 Ga0265324_10004852 3300029957 Bacteria 5931
106 Ga0307516_10001445 3300031730 Bacteria 32809
107 Ga0307516_10028233 3300031730 Bacteria 5680
108 Ga0307414_10136279 3300032004 Bacteria 1914
109 Ga0307415_100108804 3300032126 Bacteria 2052
110 Ga0307415_100312321 3300032126 Bacteria 1307
111 Ga0373934_0032114 3300035086 Bacteria 2058
112 Ga0395898_0130038 3300037466 Bacteria 2412
113 Ga0395901_0005776 3300038443 Bacteria 12530
114 Ga0436361_0034970 3300039447 Bacteria 88532
115 Ga0436361_0819273 3300039447 Bacteria 14208
116 Ga0436361_0999087 3300039447 Bacteria 7297
117 Ga0450890_000224 3300042127 Bacteria 8536
118 Ga0439459_0003865 3300042438 Bacteria 2394
119 Ga0466963_0076007 3300044694 Bacteria 2267
120 Ga0453684_0154195 3300044712 Bacteria 2726
121 Ga0451576_0178482 3300045051 Unclassified 2217
122 Ga0495650_0040463 3300046471 Bacteria 2000
123 Ga0495639_0003760 3300046475 Bacteria 6529
124 Ga0495585_0039885 3300046492 Bacteria 2638
125 Ga0495583_0000224 3300046506 Bacteria 95810
126 Ga0495606_0001614 3300046507 Bacteria 29404
127 Ga0495632_0007550 3300046519 Bacteria 6811
128 Ga0495668_0125288 3300046616 Bacteria 1406
129 Ga0495625_0084584 3300046660 Bacteria 2203
130 Ga0495669_0042527 3300046684 Bacteria 2020
131 Ga0495649_0027973 3300046694 Bacteria 3126
132 Ga0495683_0173956 3300047323 Bacteria 988
133 Ga0495686_0002569 3300047472 Bacteria 16905
134 Ga0496124_0018975 3300048927 Bacteria 6419
135 Ga0496125_0028259 3300048928 Bacteria 5071
136 Ga0501034_0000221 3300049571 Bacteria 108958
137 Ga0501068_0003038 3300049584 Bacteria 8961
138 Ga0501069_0112271 3300049585 Bacteria 1553
139 Ga0501071_0029181 3300049587 Bacteria 3891
140 Ga0501073_0006306 3300049589 Bacteria 8835
141 Ga0501079_0006277 3300049741 Bacteria 8914
142 Ga0501080_0001582 3300049742 Bacteria 19293
143 nmdc:mga0k408_45711_c1 3300050493 Bacteria 2527
144 nmdc:mga0k408_82015_c1 3300050493 Bacteria 1889
145 nmdc:mga07m45_43139_c1 3300050496 Bacteria 2529
146 Ga0500635_0000057 3300053080 Bacteria 73077
147 Ga0500646_0005262 3300053090 Bacteria 3271
148 Ga0500583_0040719 3300053092 Bacteria 2106
149 Ga0500651_0058461 3300053093 Bacteria 2411
150 Ga0500641_0007040 3300053096 Bacteria 4006
151 Ga0500642_0000927 3300053130 Bacteria 8498
152 Ga0500652_000467 3300053131 Bacteria 14320
153 Ga0500652_059569 3300053131 Bacteria 1570
154 Ga0500658_0096256 3300053134 Bacteria 1286
155 Ga0500568_0011461 3300053139 Bacteria 4111
156 Ga0500568_0054747 3300053139 Bacteria 1559
157 Ga0500577_0007059 3300053142 Bacteria 3133
158 Ga0500616_0000062 3300053153 Bacteria 245744
159 Ga0500622_0000128 3300053156 Bacteria 79659
160 Ga0500570_021811 3300053724 Bacteria 3562
161 Ga0500645_059526 3300053730 Bacteria 1106
162 Ga0501082_0075310 3300060353 Bacteria 2908
163 2886854228 2886848708 Bacteria 5632523
164 2587727185 2585428057 Bacteria 6737412
165 2587731868 2585428058 Bacteria 6853932
166 2588291597 2588253510 Bacteria 6901809
167 2831866657 2831864461 Bacteria 6502356
168 2894416313 2894414249 Bacteria 4405451
169 JGI25156J39149_1000222
170 JGI25156J39149_1000835
171 JGI25157J39369_1000056
172 JGI25157J39369_1000100
173 JGI25406J46586_10025669
174 rootH1_10001028
175 rootH1_10021924
176 rootL2_10001519
177 rootL2_10086213
178 rootH1_10013770
179 rootH1_10013771
180 rootH1_10054607
181 rootH1_10187076
182 rootH1_10402802
183 Ga0055539_1000400
184 Ga0055539_1002889
185 Ga0055533_1000080
186 Ga0055525_1001331
187 Ga0055535_1000198
188 Ga0055529_1000911
189 Ga0055526_1001599
190 Ga0055524_1001433
191 Ga0055531_10002486
192 Ga0055531_10006204
193 Ga0055531_10008645
194 Ga0065165_1000411
195 Ga0065165_1000678
196 Ga0070658_10025275
197 Ga0070658_10405127
198 Ga0070683_100173965
199 Ga0070690_100017473
200 Ga0070682_100168179
201 Ga0070660_100069284
202 Ga0068855_100004750
203 Ga0068857_100001183
204 Ga0068854_100011407
205 Ga0068856_100000722
206 Ga0068859_100166944
207 Ga0068859_100220955
208 Ga0068864_100225463
209 Ga0068861_100054241
210 Ga0068863_100271160
211 Ga0068862_100274169
212 Ga0081539_10000007
213 Ga0075366_10023262
214 Ga0075366_10086902
215 Ga0075370_10005976
216 Ga0075370_10007965
217 Ga0075370_10012173
218 Ga0097620_100166945
219 Ga0097620_100220965
220 Ga0099823_1001509
221 Ga0105241_10458162
222 Ga0105237_10042201
223 Ga0105238_10050906
224 Ga0105249_10067641
225 Ga0105239_10019812
226 Ga0105239_10043391
227 Ga0157319_1000001
228 Ga0157378_10082653
229 Ga0157376_10364515
230 Ga0213872_10001185
231 Ga0213872_10002829
232 Ga0209674_100003
233 Ga0209563_100049
234 Ga0207427_101398
235 Ga0209258_100189
236 Ga0209258_101303
237 Ga0209646_1000124
238 Ga0209026_1000085
239 Ga0209677_100135
240 Ga0209677_100203
241 Ga0209759_1000068
242 Ga0209759_1000657
243 Ga0209759_1001691
244 Ga0209759_1005098
245 Ga0209759_1022373
246 Ga0209455_1000092
247 Ga0209673_1004856
248 Ga0209564_1000005
249 Ga0209758_1000167
250 Ga0209050_1003666
251 Ga0209256_1002220
252 Ga0209256_1002624
253 Ga0209051_1002002
254 Ga0209051_1006130
255 Ga0209257_1002900
256 Ga0209257_1003449
257 Ga0207671_10152979
258 Ga0207657_10015862
259 Ga0207700_10277742
260 Ga0207670_10170176
261 Ga0207667_10002685
262 Ga0207640_10004602
263 Ga0207639_10046603
264 Ga0207674_10003076
265 Ga0207675_100110690
266 Ga0209389_1010744
267 Ga0209371_1019515
268 Ga0268265_10246738
269 Ga0265336_10000006
270 Ga0307517_10129087
271 Ga0265324_10004852
272 Ga0307516_10001445
273 Ga0307516_10028233
274 Ga0307414_10136279
275 Ga0307415_100108804
276 Ga0307415_100312321
277 Ga0373934_0032114
278 Ga0395898_0130038
279 Ga0395901_0005776
280 Ga0436361_0034970
281 Ga0436361_0819273
282 Ga0436361_0999087
283 Ga0450890_000224
284 Ga0439459_0003865
285 Ga0466963_0076007
286 Ga0453684_0154195
287 Ga0451576_0178482
288 Ga0495650_0040463
289 Ga0495639_0003760
290 Ga0495585_0039885
291 Ga0495583_0000224
292 Ga0495606_0001614
293 Ga0495632_0007550
294 Ga0495668_0125288
295 Ga0495625_0084584
296 Ga0495669_0042527
297 Ga0495649_0027973
298 Ga0495683_0173956
299 Ga0495686_0002569
300 Ga0496124_0018975
301 Ga0496125_0028259
302 Ga0501034_0000221
303 Ga0501068_0003038
304 Ga0501069_0112271
305 Ga0501071_0029181
306 Ga0501073_0006306
307 Ga0501079_0006277
308 Ga0501080_0001582
309 nmdc:mga0k408_45711_c1
310 nmdc:mga0k408_82015_c1
311 nmdc:mga07m45_43139_c1
312 Ga0500635_0000057
313 Ga0500646_0005262
314 Ga0500583_0040719
315 Ga0500651_0058461
316 Ga0500641_0007040
317 Ga0500642_0000927
318 Ga0500652_000467
319 Ga0500652_059569
320 Ga0500658_0096256
321 Ga0500568_0011461
322 Ga0500568_0054747
323 Ga0500577_0007059
324 Ga0500616_0000062
325 Ga0500622_0000128
326 Ga0500570_021811
327 Ga0500645_059526
328 Ga0501082_0075310
329 2886854228
330 2587727185
331 2587731868
332 2588291597
333 2831866657
334 2894416313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

70

271

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.9169 25 286
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.8458 25 286
5ex2-assembly2.cif.gz_B crystal structure of cyclophilin aquacyp293 from hirschia baltica 0.7961 26 291
3bo7-assembly1.cif.gz_A crystal structure of toxoplasma gondii peptidyl-prolyl cis-trans isomerase, 541.m00136 0.7886 34 229
5xjc-assembly1.cif.gz_S cryo-em structure of the human spliceosome just prior to exon ligation at 3.6 angstrom 0.7848 26 231
ID Description Score Start End Superfamily
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8331 34 208 2.40.100.10
3bo7A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7886 34 229 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7844 34 230 2.40.100.10
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.784 34 208 2.40.100.10
af_Q86IX8_29_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7596 36 202 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A2G3J8I5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9757 12 286 GO:0140839
GO:0140840
AF-A0A1I4XE05-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9728 12 285 GO:0140839
GO:0140840
AF-A0A7W3IHY8-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.972 12 285 GO:0003755
AF-A0A2S6B3Q5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9713 12 285 GO:0140839
GO:0140840
AF-A0A7H0G1M1-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9707 12 285 GO:0140839
GO:0140840

Map