F249485

General Info

Members Datasets Scaffolds Average Seq Length
166 139 332 336

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003151029|8003157006
Length 389
Sequence GGRLSDILVLNLMQGTFLCVAATYGGAISTNFVNQFYQSFIMLKSYNITLLLQAMLVLAACNETPATGGDHTAYFTPVDSGVQTGGVKIIPISTSKGTFNIWTKRTGNNPKIKVLLITGGPGATHEYAEAFDSFFPQEEIEYIYYDQLGCGNSDNPKDTALYDLNRSVEEIEQVRKALNLTNENFYIWGHSWGGVVAMEYALKYQDNLKALIISDMMASAKDYNDYADNVLAKQMDPKILDSIRAIEAKNDFDNPKYMELLMPNFYAKHICRLPEFPDPVLRAMGKINESFYRTMQGPSEFGLSGKLTNWDVKGKLPQIKVPTLSIGAKYDTMDPEHMKWIAGQVQNGSYLYCPNGSHLCMYDDQAVYMKGLVKFILAVNNGEKKVALN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
96 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
97 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
98 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
99 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
100 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
101 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
102 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
103 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
104 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
105 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
106 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
107 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
108 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
109 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
110 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
111 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
112 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
113 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
114 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
115 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
116 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
119 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
122 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
123 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
124 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
125 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
126 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
134 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
135 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
136 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
137 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
138 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
139 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 1.81
Rhizoplane 0.6
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001518 3300001979 Bacteria 10666
2 JGI24739J22299_10044009 3300001989 Unclassified 1472
3 JGI25154J39366_1000031 3300002738 Bacteria 190814
4 JGI25406J46586_10000216 3300003203 Bacteria 25386
5 JGI25153J46596_10008628 3300003215 Unclassified 4850
6 JGI25153J46596_10010152 3300003215 Bacteria 4286
7 rootL2_10262583 3300003322 Bacteria 2496
8 Ga0055526_1017812 3300003771 Bacteria 2689
9 Ga0055528_1000738 3300003790 Bacteria 22801
10 Ga0065165_1000017 3300005262 Bacteria 278286
11 Ga0065714_10006600 3300005288 Bacteria 3523
12 Ga0065714_10103531 3300005288 Bacteria 1601
13 Ga0070690_100001626 3300005330 Bacteria 11811
14 Ga0070682_100000060 3300005337 Bacteria 105136
15 Ga0070668_100027189 3300005347 Bacteria 4342
16 Ga0070669_100048439 3300005353 Bacteria 3102
17 Ga0070675_100096033 3300005354 Bacteria 2490
18 Ga0070688_100043339 3300005365 Bacteria 2772
19 Ga0070688_100175363 3300005365 Bacteria 1483
20 Ga0070709_10078804 3300005434 Bacteria 2144
21 Ga0070714_100014672 3300005435 Bacteria 6295
22 Ga0070713_100015395 3300005436 Bacteria 5715
23 Ga0070701_10030254 3300005438 Bacteria 2677
24 Ga0070701_10207362 3300005438 Bacteria 1162
25 Ga0070705_100128336 3300005440 Bacteria 1650
26 Ga0070662_100120382 3300005457 Bacteria 2011
27 Ga0070698_100056411 3300005471 Bacteria 3981
28 Ga0070698_100254483 3300005471 Bacteria 1688
29 Ga0070699_100000012 3300005518 Bacteria 246521
30 Ga0070686_100102404 3300005544 Unclassified 1937
31 Ga0070665_100068602 3300005548 Bacteria 3555
32 Ga0070664_100150425 3300005564 Bacteria 2055
33 Ga0068859_100003639 3300005617 Bacteria 15707
34 Ga0068859_100105379 3300005617 Bacteria 2879
35 Ga0068851_10000066 3300005834 Bacteria 58581
36 Ga0068851_10005394 3300005834 Bacteria 5800
37 Ga0068860_100452995 3300005843 Bacteria 1276
38 Ga0081455_10070176 3300005937 Bacteria 2910
39 Ga0081539_10000047 3300005985 Bacteria 275235
40 Ga0070717_10033012 3300006028 Bacteria 4174
41 Ga0070712_100186701 3300006175 Bacteria 1619
42 Ga0075433_10003470 3300006852 Bacteria 12173
43 Ga0075433_10073359 3300006852 Bacteria 3010
44 Ga0075434_100178811 3300006871 Bacteria 2141
45 Ga0075429_100150864 3300006880 Bacteria 2035
46 Ga0097620_100003639 3300006931 Bacteria 15707
47 Ga0097620_100105380 3300006931 Bacteria 2879
48 Ga0099824_1009673 3300006942 Bacteria 11735
49 Ga0099826_10001865 3300006948 Bacteria 13137
50 Ga0111539_10122107 3300009094 Bacteria 3053
51 Ga0105245_10679357 3300009098 Bacteria 1062
52 Ga0157371_10004684 3300013102 Bacteria 11824
53 Ga0157369_10187184 3300013105 Bacteria 2177
54 Ga0157374_10350760 3300013296 Unclassified 1466
55 Ga0182006_1009363 3300015261 Bacteria 4392
56 Ga0182006_1039332 3300015261 Bacteria 1867
57 Ga0163161_10000070 3300017792 Bacteria 103561
58 Ga0163161_10000576 3300017792 Bacteria 29505
59 Ga0213872_10001110 3300021361 Bacteria 18394
60 Ga0209646_1000009 3300025246 Bacteria 652154
61 Ga0209026_1000403 3300025250 Bacteria 38393
62 Ga0209673_1000083 3300025273 Bacteria 216509
63 Ga0209564_1001902 3300025295 Bacteria 18709
64 Ga0209564_1007541 3300025295 Bacteria 5603
65 Ga0209758_1001318 3300025297 Bacteria 30178
66 Ga0209758_1004241 3300025297 Bacteria 12130
67 Ga0209050_1000273 3300025298 Bacteria 110451
68 Ga0207426_1000339 3300025302 Bacteria 87978
69 Ga0207426_1001089 3300025302 Bacteria 25231
70 Ga0209257_1003330 3300025304 Bacteria 13906
71 Ga0207656_10005151 3300025321 Bacteria 4596
72 Ga0207656_10013780 3300025321 Bacteria 3099
73 Ga0207699_10051685 3300025906 Bacteria 2429
74 Ga0207684_10171275 3300025910 Bacteria 1872
75 Ga0207681_10056619 3300025923 Bacteria 2675
76 Ga0207700_10000183 3300025928 Bacteria 37732
77 Ga0207664_10003449 3300025929 Bacteria 10541
78 Ga0207665_10008903 3300025939 Bacteria 6592
79 Ga0207689_10112195 3300025942 Bacteria 2241
80 Ga0207679_10174914 3300025945 Bacteria 1771
81 Ga0207712_10109675 3300025961 Bacteria 2068
82 Ga0207675_100006556 3300026118 Bacteria 11014
83 Ga0209489_112195 3300027361 Bacteria 8043
84 Ga0268264_10425399 3300028381 Bacteria 1282
85 Ga0307517_10006167 3300028786 Bacteria 17857
86 Ga0307515_10000794 3300028794 Bacteria 72827
87 Ga0307515_10108549 3300028794 Bacteria 3269
88 Ga0265332_10006680 3300031238 Bacteria 5224
89 Ga0307509_10000070 3300031507 Bacteria 141228
90 Ga0307509_10033710 3300031507 Bacteria 5634
91 Ga0307408_100062479 3300031548 Bacteria 2722
92 Ga0307508_10010922 3300031616 Bacteria 8306
93 Ga0307514_10001361 3300031649 Bacteria 30951
94 Ga0307405_10020007 3300031731 Bacteria 3731
95 Ga0307413_10003804 3300031824 Bacteria 6437
96 Ga0307413_10252846 3300031824 Bacteria 1308
97 Ga0307407_10000397 3300031903 Bacteria 13211
98 Ga0307407_10049959 3300031903 Bacteria 2390
99 Ga0307412_10008852 3300031911 Bacteria 5764
100 Ga0307409_100007252 3300031995 Bacteria 6612
101 Ga0307416_100043829 3300032002 Bacteria 3507
102 Ga0307415_100081138 3300032126 Bacteria 2316
103 Ga0373949_0000292 3300035090 Bacteria 18220
104 Ga0373956_0149983 3300035119 Bacteria 1097
105 Ga0436361_0302074 3300039447 Bacteria 152020
106 Ga0436363_1689440 3300039450 Bacteria 11337
107 Ga0495609_0003331 3300046538 Bacteria 9261
108 Ga0495633_0000044 3300046558 Bacteria 171185
109 Ga0495668_0000050 3300046616 Bacteria 214716
110 Ga0495625_0003717 3300046660 Bacteria 14877
111 Ga0495625_0167604 3300046660 Bacteria 1468
112 Ga0496104_0120889 3300048907 Bacteria 2515
113 Ga0496121_0000043 3300048924 Bacteria 341882
114 Ga0496125_0000012 3300048928 Bacteria 651142
115 Ga0501292_006607 3300049515 Bacteria 1653
116 Ga0501201_001539 3300049651 Bacteria 2149
117 Ga0501207_000349 3300049654 Bacteria 4989
118 Ga0501208_001236 3300049655 Bacteria 2371
119 Ga0501211_007871 3300049658 Bacteria 1041
120 Ga0501217_001959 3300049661 Bacteria 3960
121 Ga0501217_003297 3300049661 Bacteria 3253
122 Ga0501224_002806 3300049664 Bacteria 2401
123 Ga0501227_002588 3300049665 Bacteria 3974
124 Ga0501228_000538 3300049666 Bacteria 2457
125 Ga0501230_011759 3300049667 Bacteria 1392
126 Ga0501233_000355 3300049668 Bacteria 7160
127 Ga0501235_001578 3300049669 Bacteria 4884
128 Ga0501240_003227 3300049673 Bacteria 1800
129 Ga0501240_012326 3300049673 Bacteria 1168
130 Ga0501242_002234 3300049674 Bacteria 2023
131 Ga0501243_002864 3300049675 Bacteria 2543
132 Ga0501243_003275 3300049675 Bacteria 2392
133 Ga0501248_004958 3300049678 Bacteria 1029
134 Ga0501249_004222 3300049679 Bacteria 2915
135 Ga0501257_012125 3300049686 Bacteria 1970
136 Ga0501258_004511 3300049687 Bacteria 1319
137 Ga0501259_000815 3300049688 Bacteria 5118
138 Ga0501261_000796 3300049690 Bacteria 3934
139 Ga0501221_000083 3300049704 Bacteria 10820
140 Ga0501225_0002327 3300049705 Bacteria 5861
141 Ga0501225_0056891 3300049705 Bacteria 1095
142 Ga0501234_000805 3300049707 Bacteria 4919
143 Ga0501245_001598 3300049708 Bacteria 2949
144 Ga0501081_0237596 3300049743 Bacteria 1328
145 Ga0501263_000876 3300049760 Bacteria 2585
146 Ga0501266_001683 3300049763 Bacteria 2812
147 Ga0501268_000157 3300049765 Bacteria 6188
148 Ga0501271_001262 3300049768 Bacteria 2151
149 Ga0501274_001558 3300049771 Bacteria 1758
150 Ga0501212_002395 3300049851 Bacteria 2258
151 nmdc:mga09592_122078_c1 3300050508 Bacteria 2238
152 nmdc:mga08y16_75509_c1 3300050511 Bacteria 3513
153 nmdc:mga0n895_139256_c1 3300050512 Bacteria 2454
154 nmdc:mga0n895_72664_c1 3300050512 Bacteria 3413
155 nmdc:mga0rr50_50097_c1 3300050513 Bacteria 3093
156 nmdc:mga0a205_19576_c1 3300050515 Bacteria 6384
157 nmdc:mga0a205_55243_c1 3300050515 Bacteria 3836
158 Ga0500644_0001292 3300053088 Bacteria 6811
159 Ga0500597_010082 3300053120 Unclassified 3355
160 8003157006 8003151029 Bacteria 8187759
161 2740001579 2739367857 Bacteria 5433684
162 2740006395 2739367858 Bacteria 5432813
163 2929924543 2929921140 Bacteria 8649150
164 2977233493 2977232053 Bacteria 5485925
165 8055422438 8055419101 Bacteria 5289643
166 8055423790 8055419101 Bacteria 5289643
167 JGI24740J21852_10001518
168 JGI24739J22299_10044009
169 JGI25154J39366_1000031
170 JGI25406J46586_10000216
171 JGI25153J46596_10008628
172 JGI25153J46596_10010152
173 rootL2_10262583
174 Ga0055526_1017812
175 Ga0055528_1000738
176 Ga0065165_1000017
177 Ga0065714_10006600
178 Ga0065714_10103531
179 Ga0070690_100001626
180 Ga0070682_100000060
181 Ga0070668_100027189
182 Ga0070669_100048439
183 Ga0070675_100096033
184 Ga0070688_100043339
185 Ga0070688_100175363
186 Ga0070709_10078804
187 Ga0070714_100014672
188 Ga0070713_100015395
189 Ga0070701_10030254
190 Ga0070701_10207362
191 Ga0070705_100128336
192 Ga0070662_100120382
193 Ga0070698_100056411
194 Ga0070698_100254483
195 Ga0070699_100000012
196 Ga0070686_100102404
197 Ga0070665_100068602
198 Ga0070664_100150425
199 Ga0068859_100003639
200 Ga0068859_100105379
201 Ga0068851_10000066
202 Ga0068851_10005394
203 Ga0068860_100452995
204 Ga0081455_10070176
205 Ga0081539_10000047
206 Ga0070717_10033012
207 Ga0070712_100186701
208 Ga0075433_10003470
209 Ga0075433_10073359
210 Ga0075434_100178811
211 Ga0075429_100150864
212 Ga0097620_100003639
213 Ga0097620_100105380
214 Ga0099824_1009673
215 Ga0099826_10001865
216 Ga0111539_10122107
217 Ga0105245_10679357
218 Ga0157371_10004684
219 Ga0157369_10187184
220 Ga0157374_10350760
221 Ga0182006_1009363
222 Ga0182006_1039332
223 Ga0163161_10000070
224 Ga0163161_10000576
225 Ga0213872_10001110
226 Ga0209646_1000009
227 Ga0209026_1000403
228 Ga0209673_1000083
229 Ga0209564_1001902
230 Ga0209564_1007541
231 Ga0209758_1001318
232 Ga0209758_1004241
233 Ga0209050_1000273
234 Ga0207426_1000339
235 Ga0207426_1001089
236 Ga0209257_1003330
237 Ga0207656_10005151
238 Ga0207656_10013780
239 Ga0207699_10051685
240 Ga0207684_10171275
241 Ga0207681_10056619
242 Ga0207700_10000183
243 Ga0207664_10003449
244 Ga0207665_10008903
245 Ga0207689_10112195
246 Ga0207679_10174914
247 Ga0207712_10109675
248 Ga0207675_100006556
249 Ga0209489_112195
250 Ga0268264_10425399
251 Ga0307517_10006167
252 Ga0307515_10000794
253 Ga0307515_10108549
254 Ga0265332_10006680
255 Ga0307509_10000070
256 Ga0307509_10033710
257 Ga0307408_100062479
258 Ga0307508_10010922
259 Ga0307514_10001361
260 Ga0307405_10020007
261 Ga0307413_10003804
262 Ga0307413_10252846
263 Ga0307407_10000397
264 Ga0307407_10049959
265 Ga0307412_10008852
266 Ga0307409_100007252
267 Ga0307416_100043829
268 Ga0307415_100081138
269 Ga0373949_0000292
270 Ga0373956_0149983
271 Ga0436361_0302074
272 Ga0436363_1689440
273 Ga0495609_0003331
274 Ga0495633_0000044
275 Ga0495668_0000050
276 Ga0495625_0003717
277 Ga0495625_0167604
278 Ga0496104_0120889
279 Ga0496121_0000043
280 Ga0496125_0000012
281 Ga0501292_006607
282 Ga0501201_001539
283 Ga0501207_000349
284 Ga0501208_001236
285 Ga0501211_007871
286 Ga0501217_001959
287 Ga0501217_003297
288 Ga0501224_002806
289 Ga0501227_002588
290 Ga0501228_000538
291 Ga0501230_011759
292 Ga0501233_000355
293 Ga0501235_001578
294 Ga0501240_003227
295 Ga0501240_012326
296 Ga0501242_002234
297 Ga0501243_002864
298 Ga0501243_003275
299 Ga0501248_004958
300 Ga0501249_004222
301 Ga0501257_012125
302 Ga0501258_004511
303 Ga0501259_000815
304 Ga0501261_000796
305 Ga0501221_000083
306 Ga0501225_0002327
307 Ga0501225_0056891
308 Ga0501234_000805
309 Ga0501245_001598
310 Ga0501081_0237596
311 Ga0501263_000876
312 Ga0501266_001683
313 Ga0501268_000157
314 Ga0501271_001262
315 Ga0501274_001558
316 Ga0501212_002395
317 nmdc:mga09592_122078_c1
318 nmdc:mga08y16_75509_c1
319 nmdc:mga0n895_139256_c1
320 nmdc:mga0n895_72664_c1
321 nmdc:mga0rr50_50097_c1
322 nmdc:mga0a205_19576_c1
323 nmdc:mga0a205_55243_c1
324 Ga0500644_0001292
325 Ga0500597_010082
326 8003157006
327 2740001579
328 2740006395
329 2929924543
330 2977233493
331 8055422438
332 8055423790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

108

264

0.83

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

113

365

0.81

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

114

369

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9225 47 338
7a6g-assembly1.cif.gz_A structural characterization of l-proline amide hydrolase from pseudomonas syringae 0.9158 46 337
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.9093 46 337
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9076 47 338
1xqx-assembly1.cif.gz_A crystal structure of f1-mutant s105a complex with pck 0.9075 46 337
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9485 60 337 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9222 60 337 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9175 47 338 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9093 46 337 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9027 47 338 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A519SZ51-F1-model_v4 Alpha/beta fold hydrolase 0.9929 60 341 GO:0006508
GO:0008233
GO:0016020
AF-A0A519RR88-F1-model_v4 Alpha/beta fold hydrolase 0.9918 29 341 GO:0006508
GO:0008233
GO:0016020
AF-A0A350BVS3-F1-model_v4 Proline iminopeptidase 0.9918 49 342 GO:0004177
GO:0006508
GO:0016020
AF-A0A524BIX1-F1-model_v4 Proline iminopeptidase 0.9901 46 337 GO:0004177
GO:0006508
AF-A0A848QFN0-F1-model_v4 deleted 0.9888 33 340

Map