F249582

General Info

Members Datasets Scaffolds Average Seq Length
167 122 334 246

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10111609|rootH1_101116092
Length 279
Sequence MYSSIAQARPPSDERVPGRSTRETTNGLATALDLPDPSNGIVGVLGGMGPLATIDFMAKMLKATNASADQEHVPVIVSSIPQVPDRTKAFRGEGESPLAAMLDSARRLRAAGARLLVVACNTAHLWFDEIEQAIGLPMIHLVDAAIADAVVLAGPSGKIGLLGTDATLASGLYVNRASAATPERVQWLLPTAVEMMELVMPGIEAVKAGDLPRGRRLLAEAARSLQSRGAAAVILGCTEIPVVLDSADSPVPLVDATAALARRAVEWSLSRRVPAALDA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
37 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
38 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
74 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
75 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
76 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
77 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
102 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
103 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
104 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
105 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
106 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
107 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
110 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
111 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
112 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
113 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
114 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
115 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
116 2858950400 Achromobacter sp. K91 Isolate Unclassified
117 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
118 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
119 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
120 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
121 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
122 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 0
Isolates 5.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.57
Nodule 0
Rhizoplane 0.6
Rhizosphere 55.69
Stem 0
Stem Tuber 2.4
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10111609 3300003316 Bacteria 2564
2 JGI25156J39149_1000035 3300002705 Bacteria 112093
3 JGI25154J39366_1000363 3300002738 Bacteria 25581
4 JGI25157J39369_1000048 3300002741 Bacteria 117419
5 JGI25164J39214_1004053 3300002772 Unclassified 1735
6 rootH2_10022787 3300003320 Bacteria 26438
7 rootH2_10211261 3300003320 Bacteria 1592
8 rootL2_10009031 3300003322 Bacteria 3818
9 Ga0055539_1000130 3300003752 Bacteria 80157
10 Ga0055533_1000045 3300003756 Bacteria 223637
11 Ga0055525_1000563 3300003759 Bacteria 16692
12 Ga0070676_10035511 3300005328 Bacteria 2868
13 Ga0070690_100021618 3300005330 Bacteria 3930
14 Ga0068869_100020567 3300005334 Bacteria 4527
15 Ga0070660_100030285 3300005339 Bacteria 4060
16 Ga0070661_100001209 3300005344 Bacteria 18186
17 Ga0070661_100101992 3300005344 Bacteria 2136
18 Ga0070673_100111631 3300005364 Bacteria 2268
19 Ga0070673_100321913 3300005364 Bacteria 1366
20 Ga0070659_100002954 3300005366 Bacteria 12120
21 Ga0070659_100259442 3300005366 Bacteria 1442
22 Ga0068855_100000355 3300005563 Bacteria 56724
23 Ga0068855_100010961 3300005563 Bacteria 10938
24 Ga0070664_100011057 3300005564 Bacteria 7319
25 Ga0068857_100429397 3300005577 Bacteria 1233
26 Ga0068857_100472206 3300005577 Bacteria 1175
27 Ga0068863_100134920 3300005841 Bacteria 2358
28 Ga0068860_100040521 3300005843 Bacteria 4451
29 Ga0075366_10001896 3300006195 Bacteria 10558
30 Ga0075370_10014189 3300006353 Bacteria 4245
31 Ga0075370_10015323 3300006353 Bacteria 4102
32 Ga0105240_10013762 3300009093 Bacteria 11085
33 Ga0105240_10020443 3300009093 Bacteria 8831
34 Ga0105240_10076054 3300009093 Bacteria 4140
35 Ga0105242_10019983 3300009176 Bacteria 5248
36 Ga0105237_10056648 3300009545 Bacteria 3923
37 Ga0105239_10539204 3300010375 Bacteria 1328
38 Ga0157370_10024986 3300013104 Bacteria 5912
39 Ga0157370_10065972 3300013104 Bacteria 3424
40 Ga0157369_10154379 3300013105 Bacteria 2426
41 Ga0157372_10186732 3300013307 Bacteria 2400
42 Ga0209674_100073 3300025226 Bacteria 223689
43 Ga0209563_100061 3300025230 Bacteria 274295
44 Ga0207427_102286 3300025231 Bacteria 5333
45 Ga0209258_100341 3300025242 Bacteria 68437
46 Ga0209646_1000131 3300025246 Bacteria 128289
47 Ga0209026_1000038 3300025250 Bacteria 281227
48 Ga0209677_100070 3300025253 Bacteria 143311
49 Ga0209677_100074 3300025253 Bacteria 133019
50 Ga0209759_1000031 3300025256 Bacteria 281227
51 Ga0207695_10016234 3300025913 Bacteria 8726
52 Ga0207695_10019779 3300025913 Bacteria 7739
53 Ga0207695_10063079 3300025913 Bacteria 3821
54 Ga0207657_10008209 3300025919 Bacteria 10632
55 Ga0207649_10001821 3300025920 Bacteria 12174
56 Ga0207649_10033314 3300025920 Bacteria 3077
57 Ga0207690_10098758 3300025932 Bacteria 2080
58 Ga0207690_10128707 3300025932 Bacteria 1850
59 Ga0207689_10082715 3300025942 Bacteria 2639
60 Ga0207679_10000249 3300025945 Bacteria 41064
61 Ga0207667_10002707 3300025949 Bacteria 21924
62 Ga0207667_10010267 3300025949 Bacteria 10959
63 Ga0207667_10233031 3300025949 Bacteria 1885
64 Ga0207651_10133915 3300025960 Bacteria 1902
65 Ga0207651_10300886 3300025960 Bacteria 1334
66 Ga0207658_10098317 3300025986 Bacteria 2287
67 Ga0207674_10083619 3300026116 Bacteria 3191
68 Ga0207674_10629176 3300026116 Bacteria 1036
69 Ga0207675_100022581 3300026118 Bacteria 5858
70 Ga0268264_10026080 3300028381 Bacteria 4773
71 Ga0307517_10018051 3300028786 Bacteria 9147
72 Ga0307515_10000011 3300028794 Bacteria 633903
73 Ga0307515_10000049 3300028794 Bacteria 278611
74 Ga0307515_10005178 3300028794 Bacteria 26496
75 Ga0307515_10012201 3300028794 Bacteria 16196
76 Ga0307515_10078331 3300028794 Bacteria 4348
77 Ga0307515_10088778 3300028794 Bacteria 3902
78 Ga0307513_10007259 3300031456 Bacteria 14389
79 Ga0307509_10000157 3300031507 Bacteria 106022
80 Ga0307509_10003863 3300031507 Bacteria 22193
81 Ga0307509_10007214 3300031507 Bacteria 14630
82 Ga0307509_10027496 3300031507 Bacteria 6328
83 Ga0307509_10129020 3300031507 Bacteria 2488
84 Ga0307509_10292827 3300031507 Bacteria 1381
85 Ga0307408_100134695 3300031548 Bacteria 1932
86 Ga0307508_10018215 3300031616 Bacteria 6382
87 Ga0307508_10050013 3300031616 Bacteria 3720
88 Ga0307508_10221373 3300031616 Bacteria 1492
89 Ga0307514_10012234 3300031649 Bacteria 7143
90 Ga0307514_10033993 3300031649 Bacteria 4064
91 Ga0307514_10061786 3300031649 Bacteria 2852
92 Ga0316579_10016769 3300031691 Bacteria 3205
93 Ga0316576_10160842 3300031727 Bacteria 1694
94 Ga0307516_10000116 3300031730 Bacteria 92895
95 Ga0307516_10000285 3300031730 Bacteria 65510
96 Ga0307516_10004610 3300031730 Bacteria 16906
97 Ga0307516_10124183 3300031730 Bacteria 2368
98 Ga0316577_10007542 3300031733 Bacteria 5805
99 Ga0316577_10007882 3300031733 Bacteria 5686
100 Ga0307412_10059991 3300031911 Bacteria 2552
101 Ga0307411_10354727 3300032005 Bacteria 1197
102 Ga0307507_10122154 3300033179 Bacteria 2078
103 Ga0307510_10001804 3300033180 Bacteria 23934
104 Ga0307510_10145540 3300033180 Bacteria 2002
105 Ga0307510_10204199 3300033180 Bacteria 1506
106 Ga0373931_0003370 3300035691 Bacteria 7167
107 Ga0316584_0063052 3300036712 Bacteria 2775
108 Ga0395898_0008412 3300037466 Bacteria 10909
109 Ga0395905_0026559 3300037471 Bacteria 5458
110 Ga0316581_0155517 3300037588 Bacteria 705
111 Ga0395901_0007191 3300038443 Bacteria 11226
112 Ga0451855_1714540 3300041511 Bacteria 1261
113 Ga0450919_001234 3300042121 Bacteria 3341
114 Ga0450923_016483 3300042125 Bacteria 1393
115 Ga0439458_0013223 3300042157 Bacteria 1858
116 Ga0450918_000196 3300042531 Bacteria 13608
117 Ga0451576_0777939 3300045051 Bacteria 1005
118 Ga0466967_0016964 3300045976 Bacteria 5761
119 Ga0495592_0000058 3300046454 Bacteria 101492
120 Ga0495580_0061820 3300046472 Bacteria 2628
121 Ga0495639_0008299 3300046475 Bacteria 4459
122 Ga0495585_0016010 3300046492 Bacteria 4348
123 Ga0495606_0023411 3300046507 Bacteria 4475
124 Ga0495620_0068825 3300046515 Bacteria 1453
125 Ga0495630_0110918 3300046517 Bacteria 2078
126 Ga0495648_0005507 3300046524 Bacteria 10502
127 Ga0495648_0045217 3300046524 Bacteria 2741
128 Ga0495648_0208983 3300046524 Bacteria 971
129 Ga0495666_0086971 3300046526 Bacteria 1476
130 Ga0495642_0087223 3300046528 Bacteria 1319
131 Ga0495597_0000065 3300046542 Bacteria 90745
132 Ga0495658_0017723 3300046683 Bacteria 3686
133 Ga0495604_0000396 3300047317 Bacteria 39427
134 Ga0495636_0006643 3300047318 Bacteria 4547
135 Ga0495672_0013776 3300047320 Bacteria 5563
136 Ga0495683_0184464 3300047323 Bacteria 951
137 Ga0496117_0097143 3300048920 Bacteria 1877
138 Ga0496118_0158432 3300048921 Bacteria 1404
139 Ga0496121_0022464 3300048924 Bacteria 6121
140 Ga0496124_0099006 3300048927 Bacteria 2365
141 Ga0496124_0229604 3300048927 Bacteria 1389
142 Ga0496126_0000248 3300048929 Bacteria 116557
143 Ga0501211_001663 3300049658 Bacteria 2380
144 Ga0501235_014485 3300049669 Bacteria 1738
145 Ga0501255_010575 3300049684 Bacteria 1046
146 Ga0501221_002363 3300049704 Bacteria 3124
147 Ga0501229_004208 3300049706 Bacteria 1745
148 Ga0501262_000745 3300049759 Bacteria 3757
149 Ga0501272_029227 3300049769 Bacteria 694
150 nmdc:mga07m45_21915_c2 3300050496 Bacteria 2586
151 nmdc:mga07m45_308779_c1 3300050496 Bacteria 920
152 nmdc:mga07m45_41360_c1 3300050496 Bacteria 2581
153 Ga0500647_0113755 3300053091 Bacteria 1285
154 Ga0500561_0043364 3300053137 Bacteria 1198
155 Ga0500619_000190 3300053154 Bacteria 14513
156 Ga0500622_0001935 3300053156 Bacteria 15611
157 Ga0500622_0002581 3300053156 Bacteria 12951
158 2538425977 2537561728 Bacteria 5149301
159 2644245856 2643221644 Bacteria 6865017
160 2855196111 2855195626 Bacteria 4927512
161 2858952558 2858950400 Bacteria 6783797
162 2871275458 2871272651 Bacteria 5042015
163 2871285485 2871282230 Bacteria 4917173
164 2886851241 2886848708 Bacteria 5632523
165 2891633693 2891633521 Bacteria 4602265
166 2900055540 2900051742 Bacteria 4985156
167 8048749414 8048746797 Bacteria 3557226
168 rootH1_10111609
169 JGI25156J39149_1000035
170 JGI25154J39366_1000363
171 JGI25157J39369_1000048
172 JGI25164J39214_1004053
173 rootH2_10022787
174 rootH2_10211261
175 rootL2_10009031
176 Ga0055539_1000130
177 Ga0055533_1000045
178 Ga0055525_1000563
179 Ga0070676_10035511
180 Ga0070690_100021618
181 Ga0068869_100020567
182 Ga0070660_100030285
183 Ga0070661_100001209
184 Ga0070661_100101992
185 Ga0070673_100111631
186 Ga0070673_100321913
187 Ga0070659_100002954
188 Ga0070659_100259442
189 Ga0068855_100000355
190 Ga0068855_100010961
191 Ga0070664_100011057
192 Ga0068857_100429397
193 Ga0068857_100472206
194 Ga0068863_100134920
195 Ga0068860_100040521
196 Ga0075366_10001896
197 Ga0075370_10014189
198 Ga0075370_10015323
199 Ga0105240_10013762
200 Ga0105240_10020443
201 Ga0105240_10076054
202 Ga0105242_10019983
203 Ga0105237_10056648
204 Ga0105239_10539204
205 Ga0157370_10024986
206 Ga0157370_10065972
207 Ga0157369_10154379
208 Ga0157372_10186732
209 Ga0209674_100073
210 Ga0209563_100061
211 Ga0207427_102286
212 Ga0209258_100341
213 Ga0209646_1000131
214 Ga0209026_1000038
215 Ga0209677_100070
216 Ga0209677_100074
217 Ga0209759_1000031
218 Ga0207695_10016234
219 Ga0207695_10019779
220 Ga0207695_10063079
221 Ga0207657_10008209
222 Ga0207649_10001821
223 Ga0207649_10033314
224 Ga0207690_10098758
225 Ga0207690_10128707
226 Ga0207689_10082715
227 Ga0207679_10000249
228 Ga0207667_10002707
229 Ga0207667_10010267
230 Ga0207667_10233031
231 Ga0207651_10133915
232 Ga0207651_10300886
233 Ga0207658_10098317
234 Ga0207674_10083619
235 Ga0207674_10629176
236 Ga0207675_100022581
237 Ga0268264_10026080
238 Ga0307517_10018051
239 Ga0307515_10000011
240 Ga0307515_10000049
241 Ga0307515_10005178
242 Ga0307515_10012201
243 Ga0307515_10078331
244 Ga0307515_10088778
245 Ga0307513_10007259
246 Ga0307509_10000157
247 Ga0307509_10003863
248 Ga0307509_10007214
249 Ga0307509_10027496
250 Ga0307509_10129020
251 Ga0307509_10292827
252 Ga0307408_100134695
253 Ga0307508_10018215
254 Ga0307508_10050013
255 Ga0307508_10221373
256 Ga0307514_10012234
257 Ga0307514_10033993
258 Ga0307514_10061786
259 Ga0316579_10016769
260 Ga0316576_10160842
261 Ga0307516_10000116
262 Ga0307516_10000285
263 Ga0307516_10004610
264 Ga0307516_10124183
265 Ga0316577_10007542
266 Ga0316577_10007882
267 Ga0307412_10059991
268 Ga0307411_10354727
269 Ga0307507_10122154
270 Ga0307510_10001804
271 Ga0307510_10145540
272 Ga0307510_10204199
273 Ga0373931_0003370
274 Ga0316584_0063052
275 Ga0395898_0008412
276 Ga0395905_0026559
277 Ga0316581_0155517
278 Ga0395901_0007191
279 Ga0451855_1714540
280 Ga0450919_001234
281 Ga0450923_016483
282 Ga0439458_0013223
283 Ga0450918_000196
284 Ga0451576_0777939
285 Ga0466967_0016964
286 Ga0495592_0000058
287 Ga0495580_0061820
288 Ga0495639_0008299
289 Ga0495585_0016010
290 Ga0495606_0023411
291 Ga0495620_0068825
292 Ga0495630_0110918
293 Ga0495648_0005507
294 Ga0495648_0045217
295 Ga0495648_0208983
296 Ga0495666_0086971
297 Ga0495642_0087223
298 Ga0495597_0000065
299 Ga0495658_0017723
300 Ga0495604_0000396
301 Ga0495636_0006643
302 Ga0495672_0013776
303 Ga0495683_0184464
304 Ga0496117_0097143
305 Ga0496118_0158432
306 Ga0496121_0022464
307 Ga0496124_0099006
308 Ga0496124_0229604
309 Ga0496126_0000248
310 Ga0501211_001663
311 Ga0501235_014485
312 Ga0501255_010575
313 Ga0501221_002363
314 Ga0501229_004208
315 Ga0501262_000745
316 Ga0501272_029227
317 nmdc:mga07m45_21915_c2
318 nmdc:mga07m45_308779_c1
319 nmdc:mga07m45_41360_c1
320 Ga0500647_0113755
321 Ga0500561_0043364
322 Ga0500619_000190
323 Ga0500622_0001935
324 Ga0500622_0002581
325 2538425977
326 2644245856
327 2855196111
328 2858952558
329 2871275458
330 2871285485
331 2886851241
332 2891633693
333 2900055540
334 8048749414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

45

264

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s7z-assembly1.cif.gz_B crystal structure of putative aspartate racemase from salmonella typhimurium complexed with succinate 0.9402 8 240
1jfl-assembly1.cif.gz_B crystal structure determination of aspartate racemase from an archaea 0.9241 13 236
3s7z-assembly1.cif.gz_B crystal structure of putative aspartate racemase from salmonella typhimurium complexed with succinate 0.9131 8 240
5b19-assembly1.cif.gz_B picrophilus torridus aspartate racemase 0.896 13 119
2dx7-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid 0.8929 13 236
ID Description Score Start End Superfamily
3s7zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8983 12 123 3.40.50.1860
2dx7B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8968 115 226 3.40.50.1860
af_I1MCH9_211_287_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8856 129 206 3.40.50.1860
2dx7B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8737 115 226 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.872 13 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A420KEY9-F1-model_v4 Amino acid racemase (EC 5.1.1.-) 0.9908 12 247 GO:0047661
AF-X1I6L6-F1-model_v4 Aspartate racemase 0.9826 13 115 GO:0047661
AF-A0A7C0UR41-F1-model_v4 Amino acid racemase (EC 5.1.1.-) 0.9817 13 102 GO:0047661
AF-A0A6S5G4S5-F1-model_v4 deleted 0.9794 12 123
AF-F9MSA7-F1-model_v4 deleted 0.9793 13 115

Map