F250032

General Info

Members Datasets Scaffolds Average Seq Length
167 127 334 269

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10435550|Ga0070681_104355501
Length 308
Sequence MRLSVVIPAHDEASSIAETLGGLADVLERESIDYELLVVDDASTDDTLGVVESLASRNPRVRGVRSQLPRGFGYAVRAGLDLFEGDAVAIVMADASDAPEDLVTYHRLLEAGYDCAFGSRFVPGASTDGYPALKLMLNRAANVFVRLLFRHGYNDTTNAFKAYRREVVESVQPLLSNHFNLTVELPLKAIVRGHSYAVCPVSWRNRKHGVSKLSIQEMGSRYLFIVLYVWLEHHLSRGDYRIPAGSADDAHSRDVDRRDARARQRLRPAEVVGASRTRADDDPRRVGQAAGDADPGGPASAGDRQRGA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 2.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 2.99
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10435550 3300005458 Unclassified 1223
2 JGI24740J21852_10003194 3300001979 Bacteria 7227
3 JGI25407J50210_10003692 3300003373 Unclassified 3688
4 JGI25407J50210_10017901 3300003373 Bacteria 1841
5 Ga0070666_10071577 3300005335 Bacteria 2360
6 Ga0070680_100072863 3300005336 Bacteria 2824
7 Ga0070682_100221096 3300005337 Bacteria 1348
8 Ga0070660_100017924 3300005339 Bacteria 5166
9 Ga0070661_100108303 3300005344 Bacteria 2073
10 Ga0070674_100017391 3300005356 Bacteria 4523
11 Ga0070659_100061336 3300005366 Bacteria 2972
12 Ga0070714_100005260 3300005435 Bacteria 9860
13 Ga0070705_100324505 3300005440 Bacteria 1113
14 Ga0070700_100029894 3300005441 Bacteria 3251
15 Ga0070681_10003362 3300005458 Bacteria 14953
16 Ga0070685_10011846 3300005466 Bacteria 4570
17 Ga0070706_100111595 3300005467 Bacteria 2545
18 Ga0070698_100000572 3300005471 Bacteria 39526
19 Ga0070679_100003869 3300005530 Bacteria 13753
20 Ga0070679_100250394 3300005530 Bacteria 1728
21 Ga0070679_100548876 3300005530 Unclassified 1099
22 Ga0070697_100023522 3300005536 Bacteria 4900
23 Ga0070697_100195399 3300005536 Bacteria 1718
24 Ga0070704_100018265 3300005549 Bacteria 4480
25 Ga0068859_100000877 3300005617 Bacteria 30669
26 Ga0068859_100222098 3300005617 Bacteria 1977
27 Ga0068859_100744897 3300005617 Bacteria 1069
28 Ga0068870_10141252 3300005840 Bacteria 1409
29 Ga0068858_100159029 3300005842 Bacteria 2127
30 Ga0068860_100001451 3300005843 Bacteria 25672
31 Ga0081538_10002940 3300005981 Bacteria 16262
32 Ga0081538_10005637 3300005981 Bacteria 11232
33 Ga0081538_10013756 3300005981 Bacteria 6390
34 Ga0075363_100207718 3300006048 Bacteria 1120
35 Ga0068865_100099853 3300006881 Unclassified 2123
36 Ga0097620_100000877 3300006931 Bacteria 30669
37 Ga0097620_100222097 3300006931 Bacteria 1977
38 Ga0097620_100744827 3300006931 Bacteria 1069
39 Ga0111539_10436200 3300009094 Bacteria 1525
40 Ga0105245_10325355 3300009098 Bacteria 1516
41 Ga0105247_10000110 3300009101 Bacteria 83499
42 Ga0105243_10037564 3300009148 Bacteria 3765
43 Ga0105242_10018897 3300009176 Bacteria 5396
44 Ga0105238_10097432 3300009551 Bacteria 2927
45 Ga0105239_10342967 3300010375 Bacteria 1686
46 Ga0157369_10055218 3300013105 Bacteria 4288
47 Ga0157375_10867845 3300013308 Bacteria 1048
48 Ga0206352_10377527 3300020078 Bacteria 1076
49 Ga0206350_10648523 3300020080 Bacteria 1114
50 Ga0206353_10091600 3300020082 Bacteria 2627
51 Ga0213873_10000441 3300021358 Bacteria 6729
52 Ga0213876_10002304 3300021384 Bacteria 11269
53 Ga0207710_10000138 3300025900 Bacteria 83652
54 Ga0207707_10024592 3300025912 Bacteria 5272
55 Ga0207660_10022011 3300025917 Bacteria 4292
56 Ga0207657_10001603 3300025919 Bacteria 24341
57 Ga0207652_10047627 3300025921 Bacteria 3662
58 Ga0207659_10001170 3300025926 Bacteria 15652
59 Ga0207659_10084039 3300025926 Bacteria 2361
60 Ga0207687_10063489 3300025927 Unclassified 2615
61 Ga0207664_10169893 3300025929 Bacteria 1865
62 Ga0207690_10037526 3300025932 Bacteria 3146
63 Ga0207686_10009473 3300025934 Bacteria 5286
64 Ga0207669_10193899 3300025937 Unclassified 1468
65 Ga0207661_10230544 3300025944 Bacteria 1640
66 Ga0207679_10293775 3300025945 Bacteria 1398
67 Ga0207651_10202799 3300025960 Bacteria 1591
68 Ga0207708_10021208 3300026075 Bacteria 4899
69 Ga0207702_10040030 3300026078 Bacteria 3929
70 Ga0207648_10061340 3300026089 Bacteria 3279
71 Ga0207698_10292026 3300026142 Bacteria 1513
72 Ga0265337_1002943 3300028556 Bacteria 7558
73 Ga0265326_10003014 3300028558 Bacteria 5603
74 Ga0265319_1000584 3300028563 Bacteria 24505
75 Ga0265319_1008853 3300028563 Bacteria 4362
76 Ga0265334_10108523 3300028573 Bacteria 999
77 Ga0265318_10000477 3300028577 Bacteria 29590
78 Ga0265323_10052953 3300028653 Bacteria 1435
79 Ga0265322_10003305 3300028654 Bacteria 4886
80 Ga0265322_10007007 3300028654 Bacteria 3304
81 Ga0265336_10000001 3300028666 Bacteria 916179
82 Ga0265338_10000004 3300028800 Bacteria 644793
83 Ga0265338_10008362 3300028800 Bacteria 12579
84 Ga0265338_10127805 3300028800 Bacteria 2013
85 Ga0265324_10001584 3300029957 Bacteria 12662
86 Ga0265324_10025457 3300029957 Bacteria 2098
87 Ga0265762_1020877 3300030760 Unclassified 1205
88 Ga0265330_10104513 3300031235 Bacteria 1211
89 Ga0265325_10013157 3300031241 Bacteria 4716
90 Ga0265325_10038680 3300031241 Bacteria 2517
91 Ga0265329_10029949 3300031242 Bacteria 1776
92 Ga0265340_10000002 3300031247 Bacteria 711693
93 Ga0265331_10055846 3300031250 Bacteria 1877
94 Ga0265327_10014545 3300031251 Bacteria 5139
95 Ga0265327_10045759 3300031251 Bacteria 2323
96 Ga0265316_10007162 3300031344 Bacteria 10540
97 Ga0265316_10332466 3300031344 Bacteria 1102
98 Ga0307408_100164232 3300031548 Bacteria 1767
99 Ga0307408_100350571 3300031548 Bacteria 1252
100 Ga0307408_100574691 3300031548 Bacteria 998
101 Ga0265313_10022449 3300031595 Bacteria 3422
102 Ga0265314_10002316 3300031711 Bacteria 19674
103 Ga0265314_10173481 3300031711 Bacteria 1299
104 Ga0307405_10195570 3300031731 Bacteria 1464
105 Ga0307413_10089674 3300031824 Bacteria 1998
106 Ga0307410_10046800 3300031852 Bacteria 2887
107 Ga0307410_10123872 3300031852 Bacteria 1889
108 Ga0307406_10050454 3300031901 Bacteria 2638
109 Ga0307407_10041999 3300031903 Bacteria 2561
110 Ga0307407_10077122 3300031903 Bacteria 2003
111 Ga0307409_100052665 3300031995 Bacteria 3122
112 Ga0307409_100057678 3300031995 Bacteria 3010
113 Ga0307416_100037028 3300032002 Bacteria 3749
114 Ga0307414_10050677 3300032004 Bacteria 2877
115 Ga0307411_10064127 3300032005 Bacteria 2459
116 Ga0307415_100015254 3300032126 Bacteria 4543
117 Ga0307415_100312521 3300032126 Bacteria 1306
118 Ga0373953_0136900 3300035117 Unclassified 1046
119 Ga0373955_0003305 3300035172 Bacteria 7077
120 Ga0373933_0094104 3300035724 Bacteria 1852
121 Ga0373937_0002164 3300036401 Bacteria 16463
122 Ga0373937_0110996 3300036401 Bacteria 2551
123 Ga0395900_0100697 3300037418 Bacteria 2968
124 Ga0395900_0398667 3300037418 Unclassified 1341
125 Ga0395900_0577084 3300037418 Bacteria 1067
126 Ga0395898_0003325 3300037466 Bacteria 18061
127 Ga0395898_0053866 3300037466 Bacteria 3928
128 Ga0395898_0054505 3300037466 Bacteria 3902
129 Ga0395905_0129869 3300037471 Bacteria 2370
130 Ga0395905_0563205 3300037471 Bacteria 1041
131 Ga0436364_0261941 3300037853 Bacteria 1946
132 Ga0395901_0007484 3300038443 Bacteria 11028
133 Ga0395901_0168340 3300038443 Bacteria 2300
134 Ga0436365_0382532 3300039437 Bacteria 1153
135 Ga0436365_1678823 3300039437 Bacteria 32370
136 Ga0436362_0392610 3300039453 Bacteria 1632
137 Ga0436362_0516801 3300039453 Bacteria 17104
138 Ga0466963_0331858 3300044694 Bacteria 1071
139 Ga0451576_0227647 3300045051 Bacteria 1947
140 Ga0495638_0021765 3300046460 Bacteria 4217
141 Ga0495630_0023101 3300046517 Bacteria 4595
142 Ga0495652_0004474 3300046529 Bacteria 13348
143 Ga0495587_0061584 3300046536 Bacteria 2199
144 Ga0495645_0006622 3300046543 Bacteria 8047
145 Ga0495634_0000379 3300046642 Bacteria 43465
146 Ga0495680_0316067 3300047322 Bacteria 1094
147 Ga0495684_0111251 3300047471 Bacteria 2067
148 Ga0496104_0285299 3300048907 Bacteria 1564
149 Ga0496105_0017242 3300048908 Bacteria 5785
150 Ga0496105_0368237 3300048908 Bacteria 1145
151 Ga0496109_0166157 3300048912 Bacteria 2069
152 Ga0496109_0872284 3300048912 Bacteria 838
153 Ga0496126_0045579 3300048929 Bacteria 4029
154 Ga0501033_0197637 3300049570 Unclassified 1437
155 Ga0501038_0059620 3300049574 Bacteria 3269
156 Ga0501047_0044589 3300049581 Bacteria 4286
157 Ga0501070_0003207 3300049586 Bacteria 14223
158 Ga0501072_0147350 3300049588 Bacteria 1877
159 Ga0501073_0143601 3300049589 Unclassified 1654
160 Ga0501077_0104373 3300049593 Bacteria 1796
161 Ga0501249_007443 3300049679 Unclassified 2262
162 Ga0501225_0042950 3300049705 Unclassified 1249
163 Ga0501035_0062776 3300049822 Bacteria 3305
164 Ga0501044_0005412 3300049823 Bacteria 14182
165 Ga0501044_0010265 3300049823 Bacteria 10172
166 Ga0501044_0104885 3300049823 Unclassified 2840
167 Ga0501082_0054060 3300060353 Bacteria 3461
168 Ga0070681_10435550
169 JGI24740J21852_10003194
170 JGI25407J50210_10003692
171 JGI25407J50210_10017901
172 Ga0070666_10071577
173 Ga0070680_100072863
174 Ga0070682_100221096
175 Ga0070660_100017924
176 Ga0070661_100108303
177 Ga0070674_100017391
178 Ga0070659_100061336
179 Ga0070714_100005260
180 Ga0070705_100324505
181 Ga0070700_100029894
182 Ga0070681_10003362
183 Ga0070685_10011846
184 Ga0070706_100111595
185 Ga0070698_100000572
186 Ga0070679_100003869
187 Ga0070679_100250394
188 Ga0070679_100548876
189 Ga0070697_100023522
190 Ga0070697_100195399
191 Ga0070704_100018265
192 Ga0068859_100000877
193 Ga0068859_100222098
194 Ga0068859_100744897
195 Ga0068870_10141252
196 Ga0068858_100159029
197 Ga0068860_100001451
198 Ga0081538_10002940
199 Ga0081538_10005637
200 Ga0081538_10013756
201 Ga0075363_100207718
202 Ga0068865_100099853
203 Ga0097620_100000877
204 Ga0097620_100222097
205 Ga0097620_100744827
206 Ga0111539_10436200
207 Ga0105245_10325355
208 Ga0105247_10000110
209 Ga0105243_10037564
210 Ga0105242_10018897
211 Ga0105238_10097432
212 Ga0105239_10342967
213 Ga0157369_10055218
214 Ga0157375_10867845
215 Ga0206352_10377527
216 Ga0206350_10648523
217 Ga0206353_10091600
218 Ga0213873_10000441
219 Ga0213876_10002304
220 Ga0207710_10000138
221 Ga0207707_10024592
222 Ga0207660_10022011
223 Ga0207657_10001603
224 Ga0207652_10047627
225 Ga0207659_10001170
226 Ga0207659_10084039
227 Ga0207687_10063489
228 Ga0207664_10169893
229 Ga0207690_10037526
230 Ga0207686_10009473
231 Ga0207669_10193899
232 Ga0207661_10230544
233 Ga0207679_10293775
234 Ga0207651_10202799
235 Ga0207708_10021208
236 Ga0207702_10040030
237 Ga0207648_10061340
238 Ga0207698_10292026
239 Ga0265337_1002943
240 Ga0265326_10003014
241 Ga0265319_1000584
242 Ga0265319_1008853
243 Ga0265334_10108523
244 Ga0265318_10000477
245 Ga0265323_10052953
246 Ga0265322_10003305
247 Ga0265322_10007007
248 Ga0265336_10000001
249 Ga0265338_10000004
250 Ga0265338_10008362
251 Ga0265338_10127805
252 Ga0265324_10001584
253 Ga0265324_10025457
254 Ga0265762_1020877
255 Ga0265330_10104513
256 Ga0265325_10013157
257 Ga0265325_10038680
258 Ga0265329_10029949
259 Ga0265340_10000002
260 Ga0265331_10055846
261 Ga0265327_10014545
262 Ga0265327_10045759
263 Ga0265316_10007162
264 Ga0265316_10332466
265 Ga0307408_100164232
266 Ga0307408_100350571
267 Ga0307408_100574691
268 Ga0265313_10022449
269 Ga0265314_10002316
270 Ga0265314_10173481
271 Ga0307405_10195570
272 Ga0307413_10089674
273 Ga0307410_10046800
274 Ga0307410_10123872
275 Ga0307406_10050454
276 Ga0307407_10041999
277 Ga0307407_10077122
278 Ga0307409_100052665
279 Ga0307409_100057678
280 Ga0307416_100037028
281 Ga0307414_10050677
282 Ga0307411_10064127
283 Ga0307415_100015254
284 Ga0307415_100312521
285 Ga0373953_0136900
286 Ga0373955_0003305
287 Ga0373933_0094104
288 Ga0373937_0002164
289 Ga0373937_0110996
290 Ga0395900_0100697
291 Ga0395900_0398667
292 Ga0395900_0577084
293 Ga0395898_0003325
294 Ga0395898_0053866
295 Ga0395898_0054505
296 Ga0395905_0129869
297 Ga0395905_0563205
298 Ga0436364_0261941
299 Ga0395901_0007484
300 Ga0395901_0168340
301 Ga0436365_0382532
302 Ga0436365_1678823
303 Ga0436362_0392610
304 Ga0436362_0516801
305 Ga0466963_0331858
306 Ga0451576_0227647
307 Ga0495638_0021765
308 Ga0495630_0023101
309 Ga0495652_0004474
310 Ga0495587_0061584
311 Ga0495645_0006622
312 Ga0495634_0000379
313 Ga0495680_0316067
314 Ga0495684_0111251
315 Ga0496104_0285299
316 Ga0496105_0017242
317 Ga0496105_0368237
318 Ga0496109_0166157
319 Ga0496109_0872284
320 Ga0496126_0045579
321 Ga0501033_0197637
322 Ga0501038_0059620
323 Ga0501047_0044589
324 Ga0501070_0003207
325 Ga0501072_0147350
326 Ga0501073_0143601
327 Ga0501077_0104373
328 Ga0501249_007443
329 Ga0501225_0042950
330 Ga0501035_0062776
331 Ga0501044_0005412
332 Ga0501044_0010265
333 Ga0501044_0104885
334 Ga0501082_0054060

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

4

172

0.95

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

1

224

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8705 1 239
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8494 3 239
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8098 1 232
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7942 2 233
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7934 1 239
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.881 2 240 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8618 3 230 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8513 2 229 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8512 3 230 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8387 2 216 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V5JET3-F1-model_v4 Cell wall biosynthesis glycosyltransferase 0.9718 1 245 GO:0016757
AF-A0A7V9HPZ0-F1-model_v4 Glycosyltransferase family 2 protein 0.9565 1 176 GO:0016757
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9536 2 109 GO:0005886
GO:0016757
AF-A0A0G1T886-F1-model_v4 Glycosyl transferase family 2 0.9508 2 231 GO:0004582
GO:0006488
GO:0006506
GO:0016020
GO:0035269
AF-A0A1F5WEK4-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9489 2 229 GO:0004582

Map