F250044

General Info

Members Datasets Scaffolds Average Seq Length
167 123 334 201

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100028790|Ga0070706_1000287903
Length 222
Sequence LRLGLIGCLGALVLVLIIVGIWFIGVRNHLVTLDQAVQAQWAQVENDYQRRYDLIPNLVRTVQGAANFEKSTLEAVVNARSRVGQVQAPAAAGGAPGSQSDLPNNPQAMAQFEAAQAGLSNALSRLLVVVERYPELKSNQNFLELQSQLEGTENRIAVERRRYNEVAQQFNSSVLKFPANIVANMFGFKPKAYFRGVPGSNQAPEVNFQPFGQQPAPATGTR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
81 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
82 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
83 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
122 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
123 2842903701 Olivibacter sp. R-72191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.8
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100028790 3300005467 Bacteria 5116
2 JGI24033J26618_1000427 3300002155 Bacteria 4198
3 Ga0065715_10298620 3300005293 Bacteria 1046
4 Ga0065707_10446500 3300005295 Bacteria 805
5 Ga0070683_100000054 3300005329 Bacteria 87927
6 Ga0070683_100250310 3300005329 Unclassified 1685
7 Ga0070670_100000041 3300005331 Bacteria 147849
8 Ga0070670_100079763 3300005331 Unclassified 2813
9 Ga0070677_10120797 3300005333 Bacteria 1183
10 Ga0068869_100313066 3300005334 Bacteria 1271
11 Ga0068869_100470397 3300005334 Bacteria 1045
12 Ga0068868_100002788 3300005338 Bacteria 12101
13 Ga0070661_100001541 3300005344 Bacteria 16033
14 Ga0070675_100000009 3300005354 Bacteria 245759
15 Ga0070675_100789048 3300005354 Bacteria 868
16 Ga0070671_100097394 3300005355 Bacteria 2467
17 Ga0070674_100168867 3300005356 Unclassified 1666
18 Ga0070674_100431058 3300005356 Bacteria 1084
19 Ga0070673_100403114 3300005364 Bacteria 1223
20 Ga0070659_100213125 3300005366 Bacteria 1592
21 Ga0070667_100355627 3300005367 Bacteria 1327
22 Ga0070713_100033701 3300005436 Bacteria 4106
23 Ga0070701_10067027 3300005438 Bacteria 1909
24 Ga0070708_100522017 3300005445 Bacteria 1120
25 Ga0070678_100014959 3300005456 Bacteria 4915
26 Ga0070685_10023631 3300005466 Bacteria 3368
27 Ga0070706_100103482 3300005467 Bacteria 2647
28 Ga0070707_100193782 3300005468 Bacteria 1981
29 Ga0070707_100537496 3300005468 Bacteria 1131
30 Ga0070698_100925493 3300005471 Bacteria 818
31 Ga0070699_100029596 3300005518 Bacteria 4722
32 Ga0070699_100055883 3300005518 Bacteria 3417
33 Ga0070684_100002141 3300005535 Bacteria 14568
34 Ga0070697_100102166 3300005536 Bacteria 2382
35 Ga0070672_100000941 3300005543 Bacteria 17500
36 Ga0070686_100075652 3300005544 Bacteria 2215
37 Ga0070704_100119097 3300005549 Bacteria 2024
38 Ga0068857_100071149 3300005577 Bacteria 3099
39 Ga0068854_100005460 3300005578 Bacteria 8029
40 Ga0070702_100075799 3300005615 Bacteria 2000
41 Ga0068851_10109516 3300005834 Bacteria 1473
42 Ga0070717_10001923 3300006028 Bacteria 14507
43 Ga0070716_100109970 3300006173 Bacteria 1706
44 Ga0070716_100144920 3300006173 Bacteria 1520
45 Ga0075428_100000759 3300006844 Bacteria 33540
46 Ga0075431_100000730 3300006847 Bacteria 28390
47 Ga0075431_100185372 3300006847 Bacteria 2134
48 Ga0075434_100139330 3300006871 Bacteria 2445
49 Ga0075429_100301002 3300006880 Bacteria 1404
50 Ga0075429_100393599 3300006880 Bacteria 1213
51 Ga0075436_100000155 3300006914 Bacteria 42540
52 Ga0075436_100192829 3300006914 Bacteria 1442
53 Ga0075435_100026180 3300007076 Bacteria 4548
54 Ga0075435_100047479 3300007076 Bacteria 3448
55 Ga0075435_100276829 3300007076 Bacteria 1432
56 Ga0105244_10024013 3300009036 Bacteria 3333
57 Ga0105240_10088357 3300009093 Bacteria 3792
58 Ga0111539_10000129 3300009094 Bacteria 85802
59 Ga0105245_10000904 3300009098 Bacteria 26985
60 Ga0105245_10003042 3300009098 Bacteria 15027
61 Ga0105245_10044473 3300009098 Bacteria 3963
62 Ga0114129_10044230 3300009147 Bacteria 6264
63 Ga0105242_10056921 3300009176 Bacteria 3200
64 Ga0105242_10730561 3300009176 Unclassified 972
65 Ga0157369_10006581 3300013105 Bacteria 13433
66 Ga0157374_10059167 3300013296 Bacteria 3582
67 Ga0157378_10057315 3300013297 Bacteria 3472
68 Ga0163162_10020563 3300013306 Bacteria 6485
69 Ga0157372_10447213 3300013307 Bacteria 1506
70 Ga0157372_11981025 3300013307 Bacteria 669
71 Ga0157375_10000035 3300013308 Bacteria 179166
72 Ga0157375_10000303 3300013308 Bacteria 44672
73 Ga0157376_10000049 3300014969 Bacteria 104672
74 Ga0157376_11080972 3300014969 Bacteria 827
75 Ga0213873_10000002 3300021358 Bacteria 1164195
76 Ga0213876_10000010 3300021384 Bacteria 492549
77 Ga0213876_10000012 3300021384 Bacteria 396530
78 Ga0213876_10026831 3300021384 Bacteria 3039
79 Ga0213876_10245100 3300021384 Bacteria 952
80 Ga0207655_1044759 3300025728 Bacteria 1856
81 Ga0207688_10102808 3300025901 Bacteria 1652
82 Ga0207643_10036029 3300025908 Unclassified 2775
83 Ga0207684_10022559 3300025910 Bacteria 5374
84 Ga0207649_10000107 3300025920 Bacteria 69186
85 Ga0207646_10084214 3300025922 Bacteria 2845
86 Ga0207650_10000088 3300025925 Bacteria 123236
87 Ga0207650_10122656 3300025925 Bacteria 2025
88 Ga0207659_10000007 3300025926 Bacteria 322984
89 Ga0207659_10997774 3300025926 Bacteria 720
90 Ga0207687_10000157 3300025927 Bacteria 45617
91 Ga0207687_10001520 3300025927 Bacteria 15891
92 Ga0207700_10039631 3300025928 Bacteria 3432
93 Ga0207644_10054440 3300025931 Bacteria 2882
94 Ga0207686_10062317 3300025934 Bacteria 2368
95 Ga0207665_10142247 3300025939 Bacteria 1712
96 Ga0207665_10177624 3300025939 Bacteria 1541
97 Ga0207665_10527024 3300025939 Unclassified 915
98 Ga0207691_10002608 3300025940 Bacteria 17602
99 Ga0207661_10000001 3300025944 Bacteria 937688
100 Ga0207661_10218405 3300025944 Unclassified 1684
101 Ga0207640_10005065 3300025981 Bacteria 7171
102 Ga0207677_10000089 3300026023 Bacteria 76102
103 Ga0207639_10000003 3300026041 Bacteria 806887
104 Ga0207674_10087292 3300026116 Bacteria 3113
105 Ga0207683_10045531 3300026121 Bacteria 3837
106 Ga0207683_10428385 3300026121 Bacteria 1219
107 Ga0207428_10000189 3300027907 Bacteria 85810
108 Ga0265337_1005076 3300028556 Bacteria 5313
109 Ga0265334_10172123 3300028573 Bacteria 758
110 Ga0316177_1035139 3300030731 Bacteria 21564
111 Ga0316176_1162505 3300030732 Bacteria 1387
112 Ga0316183_1006105 3300030742 Bacteria 90612
113 Ga0316181_1167506 3300030744 Bacteria 16152
114 Ga0265332_10040912 3300031238 Bacteria 2006
115 Ga0265320_10007801 3300031240 Bacteria 6611
116 Ga0265316_10019410 3300031344 Bacteria 5817
117 Ga0307408_100202848 3300031548 Bacteria 1606
118 Ga0307408_100206244 3300031548 Unclassified 1594
119 Ga0265314_10019969 3300031711 Bacteria 5180
120 Ga0316576_10118012 3300031727 Bacteria 1991
121 Ga0316578_10281665 3300031728 Bacteria 995
122 Ga0316577_10037461 3300031733 Bacteria 2712
123 Ga0307412_10000490 3300031911 Bacteria 23654
124 Ga0316583_10004353 3300032133 Bacteria 5051
125 Ga0316583_10014301 3300032133 Bacteria 2863
126 Ga0373932_0000223 3300035112 Bacteria 16939
127 Ga0373943_0290450 3300035170 Bacteria 926
128 Ga0373955_0201453 3300035172 Bacteria 1185
129 Ga0373937_0327466 3300036401 Bacteria 1450
130 Ga0316582_0411856 3300036647 Bacteria 931
131 Ga0316582_0468543 3300036647 Bacteria 868
132 Ga0316584_0197924 3300036712 Bacteria 1484
133 Ga0436365_0203832 3300039437 Bacteria 1773
134 Ga0436365_0597955 3300039437 Bacteria 8681
135 Ga0436365_0800228 3300039437 Bacteria 36005
136 Ga0436365_1718738 3300039437 Bacteria 73809
137 Ga0436362_0768347 3300039453 Bacteria 63778
138 Ga0451839_0506714 3300041496 Bacteria 1390
139 Ga0451577_0137877 3300042876 Bacteria 2191
140 Ga0453683_0003071 3300044673 Bacteria 12498
141 Ga0453683_0076341 3300044673 Bacteria 2098
142 Ga0453683_0119697 3300044673 Bacteria 1657
143 Ga0453684_0000054 3300044712 Bacteria 543775
144 Ga0453684_0006483 3300044712 Bacteria 22199
145 Ga0495620_0000891 3300046515 Bacteria 18314
146 Ga0496102_0396731 3300048905 Bacteria 1297
147 Ga0496108_0361270 3300048911 Bacteria 1267
148 Ga0496109_0078655 3300048912 Bacteria 3037
149 Ga0501033_0001047 3300049570 Bacteria 25220
150 Ga0501038_0046971 3300049574 Bacteria 3741
151 Ga0501067_0013539 3300049583 Bacteria 4518
152 Ga0501073_0003561 3300049589 Bacteria 11703
153 Ga0501080_0008792 3300049742 Bacteria 9178
154 nmdc:mga05p37_296653_c1 3300050507 Bacteria 1922
155 nmdc:mga09592_115925_c1 3300050508 Bacteria 2299
156 nmdc:mga09592_376165_c1 3300050508 Bacteria 1228
157 nmdc:mga06r32_1777_c1 3300050510 Bacteria 19380
158 nmdc:mga06r32_286104_c1 3300050510 Bacteria 1635
159 nmdc:mga08y16_28_c1 3300050511 Bacteria 201429
160 nmdc:mga0rr50_21190_c1 3300050513 Bacteria 4432
161 nmdc:mga0rr50_231218_c1 3300050513 Bacteria 1530
162 nmdc:mga0rr50_53_c1 3300050513 Bacteria 63727
163 nmdc:mga08x19_2211_c1 3300050514 Bacteria 11889
164 nmdc:mga08x19_458_c1 3300050514 Bacteria 27730
165 Ga0495655_0000519 3300053083 Bacteria 6332
166 Ga0500645_017743 3300053730 Bacteria 2227
167 2842907306 2842903701 Bacteria 6986368
168 Ga0070706_100028790
169 JGI24033J26618_1000427
170 Ga0065715_10298620
171 Ga0065707_10446500
172 Ga0070683_100000054
173 Ga0070683_100250310
174 Ga0070670_100000041
175 Ga0070670_100079763
176 Ga0070677_10120797
177 Ga0068869_100313066
178 Ga0068869_100470397
179 Ga0068868_100002788
180 Ga0070661_100001541
181 Ga0070675_100000009
182 Ga0070675_100789048
183 Ga0070671_100097394
184 Ga0070674_100168867
185 Ga0070674_100431058
186 Ga0070673_100403114
187 Ga0070659_100213125
188 Ga0070667_100355627
189 Ga0070713_100033701
190 Ga0070701_10067027
191 Ga0070708_100522017
192 Ga0070678_100014959
193 Ga0070685_10023631
194 Ga0070706_100103482
195 Ga0070707_100193782
196 Ga0070707_100537496
197 Ga0070698_100925493
198 Ga0070699_100029596
199 Ga0070699_100055883
200 Ga0070684_100002141
201 Ga0070697_100102166
202 Ga0070672_100000941
203 Ga0070686_100075652
204 Ga0070704_100119097
205 Ga0068857_100071149
206 Ga0068854_100005460
207 Ga0070702_100075799
208 Ga0068851_10109516
209 Ga0070717_10001923
210 Ga0070716_100109970
211 Ga0070716_100144920
212 Ga0075428_100000759
213 Ga0075431_100000730
214 Ga0075431_100185372
215 Ga0075434_100139330
216 Ga0075429_100301002
217 Ga0075429_100393599
218 Ga0075436_100000155
219 Ga0075436_100192829
220 Ga0075435_100026180
221 Ga0075435_100047479
222 Ga0075435_100276829
223 Ga0105244_10024013
224 Ga0105240_10088357
225 Ga0111539_10000129
226 Ga0105245_10000904
227 Ga0105245_10003042
228 Ga0105245_10044473
229 Ga0114129_10044230
230 Ga0105242_10056921
231 Ga0105242_10730561
232 Ga0157369_10006581
233 Ga0157374_10059167
234 Ga0157378_10057315
235 Ga0163162_10020563
236 Ga0157372_10447213
237 Ga0157372_11981025
238 Ga0157375_10000035
239 Ga0157375_10000303
240 Ga0157376_10000049
241 Ga0157376_11080972
242 Ga0213873_10000002
243 Ga0213876_10000010
244 Ga0213876_10000012
245 Ga0213876_10026831
246 Ga0213876_10245100
247 Ga0207655_1044759
248 Ga0207688_10102808
249 Ga0207643_10036029
250 Ga0207684_10022559
251 Ga0207649_10000107
252 Ga0207646_10084214
253 Ga0207650_10000088
254 Ga0207650_10122656
255 Ga0207659_10000007
256 Ga0207659_10997774
257 Ga0207687_10000157
258 Ga0207687_10001520
259 Ga0207700_10039631
260 Ga0207644_10054440
261 Ga0207686_10062317
262 Ga0207665_10142247
263 Ga0207665_10177624
264 Ga0207665_10527024
265 Ga0207691_10002608
266 Ga0207661_10000001
267 Ga0207661_10218405
268 Ga0207640_10005065
269 Ga0207677_10000089
270 Ga0207639_10000003
271 Ga0207674_10087292
272 Ga0207683_10045531
273 Ga0207683_10428385
274 Ga0207428_10000189
275 Ga0265337_1005076
276 Ga0265334_10172123
277 Ga0316177_1035139
278 Ga0316176_1162505
279 Ga0316183_1006105
280 Ga0316181_1167506
281 Ga0265332_10040912
282 Ga0265320_10007801
283 Ga0265316_10019410
284 Ga0307408_100202848
285 Ga0307408_100206244
286 Ga0265314_10019969
287 Ga0316576_10118012
288 Ga0316578_10281665
289 Ga0316577_10037461
290 Ga0307412_10000490
291 Ga0316583_10004353
292 Ga0316583_10014301
293 Ga0373932_0000223
294 Ga0373943_0290450
295 Ga0373955_0201453
296 Ga0373937_0327466
297 Ga0316582_0411856
298 Ga0316582_0468543
299 Ga0316584_0197924
300 Ga0436365_0203832
301 Ga0436365_0597955
302 Ga0436365_0800228
303 Ga0436365_1718738
304 Ga0436362_0768347
305 Ga0451839_0506714
306 Ga0451577_0137877
307 Ga0453683_0003071
308 Ga0453683_0076341
309 Ga0453683_0119697
310 Ga0453684_0000054
311 Ga0453684_0006483
312 Ga0495620_0000891
313 Ga0496102_0396731
314 Ga0496108_0361270
315 Ga0496109_0078655
316 Ga0501033_0001047
317 Ga0501038_0046971
318 Ga0501067_0013539
319 Ga0501073_0003561
320 Ga0501080_0008792
321 nmdc:mga05p37_296653_c1
322 nmdc:mga09592_115925_c1
323 nmdc:mga09592_376165_c1
324 nmdc:mga06r32_1777_c1
325 nmdc:mga06r32_286104_c1
326 nmdc:mga08y16_28_c1
327 nmdc:mga0rr50_21190_c1
328 nmdc:mga0rr50_231218_c1
329 nmdc:mga0rr50_53_c1
330 nmdc:mga08x19_2211_c1
331 nmdc:mga08x19_458_c1
332 Ga0495655_0000519
333 Ga0500645_017743
334 2842907306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

40

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9012 19 177
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8843 19 177
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.649 34 138
7rro-assembly1.cif.gz_C5 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.6371 16 156
7rro-assembly1.cif.gz_C5 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.6266 16 156
ID Description Score Start End Superfamily
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8326 14 188 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8106 14 188 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7327 2 177 1.10.287.1490
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6678 2 177 1.10.287.1490
4onsC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6496 14 117 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A2V6BI24-F1-model_v4 LemA family protein 0.963 2 173 GO:0016020
AF-A0A351Y496-F1-model_v4 LemA protein 0.962 2 176 GO:0016020
AF-A0A1V5SLZ8-F1-model_v4 LemA family protein 0.9601 2 188 GO:0016020
AF-A0A4Q3R6K2-F1-model_v4 LemA family protein 0.959 13 189 GO:0016020
AF-A0A3P5VPY5-F1-model_v4 deleted 0.9587 22 188

Map