F250393

General Info

Members Datasets Scaffolds Average Seq Length
167 129 167 168

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10141812|Ga0105245_101418123
Length 184
Sequence LTAQFHWNPETYLAEIRGEVPRYDELQRAAVDAIPFAPGRVLELGMGTGETTRVLLEAYPDAWVIGLDSNPDMVFRLRQEYDDVQLARMEDPLPDGPWDLVISVLSVHHLTDDQKHLLFRRVREQARALVIGDVVKTEKQITPIDPGIDFPDTAEELAEWCGGEITWTADDLAVVRATYEEKES

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
44 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
67 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
125 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 11.38
Rhizosphere 83.83
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000251 3300002074 Bacteria 6385
2 JGI24034J26672_10002830 3300002239 Bacteria 2396
3 JGI24742J22300_10000513 3300002244 Bacteria 5770
4 Ga0070683_101805759 3300005329 Bacteria 588
5 Ga0070710_10037877 3300005437 Bacteria 2646
6 Ga0070708_100167323 3300005445 Bacteria 2051
7 Ga0070684_100415242 3300005535 Bacteria 1242
8 Ga0070686_100078871 3300005544 Bacteria 2175
9 Ga0070693_100640175 3300005547 Bacteria 772
10 Ga0070704_100158637 3300005549 Bacteria 1787
11 Ga0070664_100254845 3300005564 Bacteria 1578
12 Ga0068857_100395102 3300005577 Unclassified 1286
13 Ga0068864_100000031 3300005618 Bacteria 215331
14 Ga0068866_10000123 3300005718 Bacteria 33904
15 Ga0081455_10005635 3300005937 Bacteria 13676
16 Ga0081455_10103131 3300005937 Bacteria 2285
17 Ga0081455_10333244 3300005937 Bacteria 1076
18 Ga0081538_10177741 3300005981 Bacteria 916
19 Ga0081540_1000265 3300005983 Bacteria 55107
20 Ga0081540_1183594 3300005983 Bacteria 779
21 Ga0075365_10151036 3300006038 Unclassified 1616
22 Ga0075365_10425626 3300006038 Bacteria 937
23 Ga0075364_10120985 3300006051 Bacteria 1752
24 Ga0075364_10475505 3300006051 Unclassified 854
25 Ga0075431_100135362 3300006847 Bacteria 2540
26 Ga0075433_10000373 3300006852 Bacteria 28166
27 Ga0105245_10000336 3300009098 Bacteria 44275
28 Ga0105245_10141812 3300009098 Bacteria 2264
29 Ga0105242_10202532 3300009176 Bacteria 1764
30 Ga0105249_10000050 3300009553 Bacteria 169617
31 Ga0105249_10300593 3300009553 Unclassified 1609
32 Ga0105249_10725980 3300009553 Bacteria 1055
33 Ga0157374_10000678 3300013296 Bacteria 29993
34 Ga0163162_10102292 3300013306 Bacteria 2958
35 Ga0157380_11781394 3300014326 Bacteria 675
36 Ga0157379_10014404 3300014968 Bacteria 6938
37 Ga0207682_10000013 3300025893 Bacteria 83196
38 Ga0207692_10314299 3300025898 Bacteria 957
39 Ga0207642_10000154 3300025899 Bacteria 19565
40 Ga0207649_10582087 3300025920 Unclassified 859
41 Ga0207687_10000013 3300025927 Bacteria 299826
42 Ga0207686_10008093 3300025934 Bacteria 5671
43 Ga0207669_10000006 3300025937 Bacteria 176348
44 Ga0207661_11069745 3300025944 Bacteria 743
45 Ga0207679_10287628 3300025945 Unclassified 1412
46 Ga0207658_10041201 3300025986 Bacteria 3343
47 Ga0207677_10000257 3300026023 Bacteria 40780
48 Ga0207648_10010326 3300026089 Bacteria 8856
49 Ga0207676_10000031 3300026095 Bacteria 215877
50 Ga0207675_100268804 3300026118 Bacteria 1654
51 Ga0207675_100843730 3300026118 Unclassified 931
52 Ga0265337_1000006 3300028556 Bacteria 99562
53 Ga0265326_10000072 3300028558 Bacteria 57044
54 Ga0265319_1000073 3300028563 Bacteria 81138
55 Ga0265322_10000001 3300028654 Bacteria 543854
56 Ga0265336_10003283 3300028666 Bacteria 6381
57 Ga0265338_10000464 3300028800 Bacteria 72259
58 Ga0265324_10000317 3300029957 Bacteria 35454
59 Ga0265324_10081456 3300029957 Bacteria 1101
60 Ga0265332_10085361 3300031238 Bacteria 1338
61 Ga0265320_10000002 3300031240 Bacteria 542875
62 Ga0265325_10017088 3300031241 Bacteria 4038
63 Ga0265329_10023573 3300031242 Bacteria 2049
64 Ga0265339_10022680 3300031249 Bacteria 3634
65 Ga0265331_10000921 3300031250 Bacteria 23544
66 Ga0265327_10000011 3300031251 Bacteria 543807
67 Ga0265316_10042109 3300031344 Bacteria 3651
68 Ga0265313_10130702 3300031595 Bacteria 1088
69 Ga0265314_10000487 3300031711 Bacteria 51708
70 Ga0373937_0703971 3300036401 Bacteria 957
71 Ga0395899_0418283 3300037312 Bacteria 884
72 Ga0395900_0238555 3300037418 Bacteria 1825
73 Ga0395900_0350878 3300037418 Bacteria 1449
74 Ga0395898_0104484 3300037466 Bacteria 2717
75 Ga0395905_1316524 3300037471 Bacteria 626
76 Ga0395901_0211057 3300038443 Bacteria 2032
77 Ga0395901_1451970 3300038443 Bacteria 643
78 Ga0451791_0442324 3300041451 Unclassified 902
79 Ga0451800_1668469 3300041459 Bacteria 625
80 Ga0451807_2204000 3300041486 Unclassified 614
81 Ga0451849_1329697 3300041505 Unclassified 980
82 Ga0451853_3047088 3300041512 Bacteria 1229
83 Ga0466963_0001633 3300044694 Bacteria 12212
84 Ga0466963_0110930 3300044694 Bacteria 1883
85 Ga0466967_0069438 3300045976 Bacteria 3149
86 Ga0466967_0176848 3300045976 Bacteria 2011
87 Ga0495603_0000389 3300046455 Bacteria 24062
88 Ga0495603_0013109 3300046455 Bacteria 5010
89 Ga0495629_0279332 3300046459 Bacteria 1146
90 Ga0495629_0362053 3300046459 Bacteria 988
91 Ga0495641_0403082 3300046461 Bacteria 621
92 Ga0495584_0317641 3300046491 Bacteria 791
93 Ga0495608_0730667 3300046511 Bacteria 588
94 Ga0495628_0000044 3300046516 Bacteria 99014
95 Ga0495628_0045802 3300046516 Bacteria 3476
96 Ga0495628_0373560 3300046516 Bacteria 1045
97 Ga0495630_0016974 3300046517 Bacteria 5327
98 Ga0495630_0326963 3300046517 Bacteria 1172
99 Ga0495644_0054721 3300046523 Bacteria 1499
100 Ga0495652_0267444 3300046529 Bacteria 1258
101 Ga0495652_0726263 3300046529 Unclassified 666
102 Ga0495640_0734604 3300046533 Unclassified 591
103 Ga0495645_0275269 3300046543 Unclassified 1109
104 Ga0495656_0196021 3300046615 Bacteria 1000
105 Ga0495634_0000034 3300046642 Bacteria 106338
106 Ga0495634_0185923 3300046642 Bacteria 1298
107 Ga0495634_0259943 3300046642 Bacteria 1059
108 Ga0495635_0034912 3300046663 Bacteria 3488
109 Ga0495635_0548986 3300046663 Unclassified 758
110 Ga0495657_0133349 3300046675 Unclassified 1554
111 Ga0495647_0046591 3300046681 Bacteria 1671
112 Ga0495658_0518645 3300046683 Unclassified 763
113 Ga0495669_0000580 3300046684 Bacteria 16226
114 Ga0495600_0365136 3300046809 Unclassified 903
115 Ga0495600_0720557 3300046809 Unclassified 599
116 Ga0495680_0024463 3300047322 Bacteria 5010
117 Ga0495685_027984 3300047447 Bacteria 1939
118 Ga0495684_0175634 3300047471 Bacteria 1590
119 Ga0495602_0003302 3300048088 Bacteria 16655
120 Ga0496102_1235905 3300048905 Unclassified 666
121 Ga0496104_0000009 3300048907 Bacteria 488055
122 Ga0496105_0000007 3300048908 Bacteria 339658
123 Ga0496105_0014548 3300048908 Bacteria 6265
124 Ga0496107_0376716 3300048910 Bacteria 1056
125 Ga0496108_0019027 3300048911 Bacteria 5633
126 Ga0496109_0284536 3300048912 Unclassified 1558
127 Ga0496109_1800736 3300048912 Unclassified 545
128 Ga0496110_0073460 3300048913 Bacteria 3035
129 Ga0496110_0116518 3300048913 Bacteria 2405
130 Ga0496111_0249559 3300048914 Unclassified 1317
131 Ga0496111_0662016 3300048914 Bacteria 761
132 Ga0496113_0014270 3300048916 Bacteria 5416
133 Ga0496113_0420553 3300048916 Bacteria 1073
134 Ga0496114_0566105 3300048917 Bacteria 1003
135 Ga0496115_0017935 3300048918 Bacteria 5422
136 Ga0495678_215181 3300049459 Unclassified 586
137 Ga0501036_0217074 3300049572 Bacteria 1606
138 Ga0501039_0274282 3300049575 Bacteria 1326
139 Ga0501042_0447477 3300049578 Bacteria 937
140 Ga0501048_0089060 3300049582 Bacteria 2177
141 Ga0501072_0197905 3300049588 Bacteria 1602
142 Ga0501074_0633060 3300049590 Bacteria 756
143 Ga0501075_0371424 3300049591 Bacteria 1090
144 Ga0501076_0490955 3300049592 Unclassified 1012
145 Ga0501079_0086391 3300049741 Bacteria 2428
146 Ga0501081_0443582 3300049743 Bacteria 964
147 Ga0501045_0171504 3300049824 Unclassified 1616
148 nmdc:mga00v17_56170_c1 3300050491 Bacteria 2406
149 nmdc:mga0yw44_15097_c1 3300050492 Bacteria 4125
150 nmdc:mga06r32_138267_c1 3300050510 Bacteria 2410
151 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
152 Ga0495601_0001717 3300053077 Bacteria 12112
153 Ga0495601_0059234 3300053077 Bacteria 2428
154 Ga0495612_0000955 3300053078 Bacteria 11867
155 Ga0495612_0032819 3300053078 Bacteria 2099
156 Ga0495655_0059967 3300053083 Bacteria 1035
157 Ga0495595_0073897 3300053084 Bacteria 1615
158 Ga0495595_0226578 3300053084 Bacteria 933
159 Ga0495595_0320025 3300053084 Unclassified 781
160 Ga0495619_0000077 3300053085 Bacteria 73017
161 Ga0495619_0000373 3300053085 Bacteria 30829
162 Ga0495619_0021136 3300053085 Bacteria 4152
163 Ga0495619_0025542 3300053085 Bacteria 3795
164 Ga0495619_0135076 3300053085 Bacteria 1696
165 Ga0495619_1034502 3300053085 Bacteria 548
166 Ga0501084_0389981 3300054114 Bacteria 1177
167 Ga0530510_0238313 3300061734 Bacteria 1354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_1668469 Ga0451800_1668469_36_503 135
2 3300049572 Ga0501036_0217074 Ga0501036_0217074_141_638 159
3 3300049575 Ga0501039_0274282 Ga0501039_0274282_225_722 159
4 3300049582 Ga0501048_0089060 Ga0501048_0089060_1060_1557 159
5 3300049588 Ga0501072_0197905 Ga0501072_0197905_51_548 159
6 3300049741 Ga0501079_0086391 Ga0501079_0086391_285_782 159
7 3300049824 Ga0501045_0171504 Ga0501045_0171504_463_984 159
8 3300046491 Ga0495584_0317641 Ga0495584_0317641_178_714 162
9 3300002074 JGI24748J21848_1000251 JGI24748J21848_10002517 164
10 3300002239 JGI24034J26672_10002830 JGI24034J26672_100028303 164
11 3300002244 JGI24742J22300_10000513 JGI24742J22300_100005133 164
12 3300005329 Ga0070683_101805759 Ga0070683_1018057591 164
13 3300005437 Ga0070710_10037877 Ga0070710_100378774 164
14 3300005445 Ga0070708_100167323 Ga0070708_1001673234 164
15 3300005535 Ga0070684_100415242 Ga0070684_1004152422 164
16 3300005544 Ga0070686_100078871 Ga0070686_1000788714 164
17 3300005547 Ga0070693_100640175 Ga0070693_1006401751 164
18 3300005549 Ga0070704_100158637 Ga0070704_1001586371 164
19 3300005564 Ga0070664_100254845 Ga0070664_1002548453 164
20 3300005577 Ga0068857_100395102 Ga0068857_1003951023 164
21 3300005618 Ga0068864_100000031 Ga0068864_100000031127 164
22 3300005718 Ga0068866_10000123 Ga0068866_100001232 164
23 3300005937 Ga0081455_10005635 Ga0081455_100056357 164
24 3300005937 Ga0081455_10103131 Ga0081455_101031312 164
25 3300005937 Ga0081455_10333244 Ga0081455_103332441 164
26 3300005981 Ga0081538_10177741 Ga0081538_101777412 164
27 3300005983 Ga0081540_1000265 Ga0081540_100026555 164
28 3300005983 Ga0081540_1183594 Ga0081540_11835942 164
29 3300006038 Ga0075365_10151036 Ga0075365_101510361 164
30 3300006038 Ga0075365_10425626 Ga0075365_104256262 164
31 3300006051 Ga0075364_10120985 Ga0075364_101209853 164
32 3300006051 Ga0075364_10475505 Ga0075364_104755052 164
33 3300006847 Ga0075431_100135362 Ga0075431_1001353623 164
34 3300006852 Ga0075433_10000373 Ga0075433_1000037329 164
35 3300009098 Ga0105245_10000336 Ga0105245_100003369 164
36 3300009098 Ga0105245_10141812 Ga0105245_101418123 164
37 3300009176 Ga0105242_10202532 Ga0105242_102025322 164
38 3300009553 Ga0105249_10000050 Ga0105249_10000050108 164
39 3300009553 Ga0105249_10300593 Ga0105249_103005933 164
40 3300009553 Ga0105249_10725980 Ga0105249_107259801 164
41 3300013296 Ga0157374_10000678 Ga0157374_100006785 164
42 3300013306 Ga0163162_10102292 Ga0163162_101022922 164
43 3300014326 Ga0157380_11781394 Ga0157380_117813941 164
44 3300014968 Ga0157379_10014404 Ga0157379_100144046 164
45 3300025893 Ga0207682_10000013 Ga0207682_1000001360 164
46 3300025898 Ga0207692_10314299 Ga0207692_103142992 164
47 3300025899 Ga0207642_10000154 Ga0207642_1000015423 164
48 3300025920 Ga0207649_10582087 Ga0207649_105820871 164
49 3300025927 Ga0207687_10000013 Ga0207687_10000013269 164
50 3300025934 Ga0207686_10008093 Ga0207686_100080937 164
51 3300025937 Ga0207669_10000006 Ga0207669_1000000658 164
52 3300025944 Ga0207661_11069745 Ga0207661_110697451 164
53 3300025945 Ga0207679_10287628 Ga0207679_102876282 164
54 3300025986 Ga0207658_10041201 Ga0207658_100412014 164
55 3300026023 Ga0207677_10000257 Ga0207677_100002578 164
56 3300026089 Ga0207648_10010326 Ga0207648_100103268 164
57 3300026095 Ga0207676_10000031 Ga0207676_10000031126 164
58 3300026118 Ga0207675_100268804 Ga0207675_1002688042 164
59 3300026118 Ga0207675_100843730 Ga0207675_1008437302 164
60 3300028556 Ga0265337_1000006 Ga0265337_100000646 164
61 3300028558 Ga0265326_10000072 Ga0265326_1000007234 164
62 3300028563 Ga0265319_1000073 Ga0265319_100007358 164
63 3300028654 Ga0265322_10000001 Ga0265322_10000001544 164
64 3300028666 Ga0265336_10003283 Ga0265336_100032836 164
65 3300028800 Ga0265338_10000464 Ga0265338_1000046436 164
66 3300029957 Ga0265324_10000317 Ga0265324_1000031734 164
67 3300029957 Ga0265324_10081456 Ga0265324_100814562 164
68 3300031238 Ga0265332_10085361 Ga0265332_100853612 164
69 3300031240 Ga0265320_10000002 Ga0265320_10000002543 164
70 3300031241 Ga0265325_10017088 Ga0265325_100170885 164
71 3300031242 Ga0265329_10023573 Ga0265329_100235732 164
72 3300031249 Ga0265339_10022680 Ga0265339_100226805 164
73 3300031250 Ga0265331_10000921 Ga0265331_1000092116 164
74 3300031251 Ga0265327_10000011 Ga0265327_10000011543 164
75 3300031344 Ga0265316_10042109 Ga0265316_100421095 164
76 3300031595 Ga0265313_10130702 Ga0265313_101307022 164
77 3300031711 Ga0265314_10000487 Ga0265314_1000048721 164
78 3300036401 Ga0373937_0703971 Ga0373937_0703971_311_805 164
79 3300037312 Ga0395899_0418283 Ga0395899_0418283_14_556 164
80 3300037418 Ga0395900_0238555 Ga0395900_0238555_1037_1579 164
81 3300037418 Ga0395900_0350878 Ga0395900_0350878_218_772 164
82 3300037466 Ga0395898_0104484 Ga0395898_0104484_2144_2686 164
83 3300037471 Ga0395905_1316524 Ga0395905_1316524_46_588 164
84 3300038443 Ga0395901_0211057 Ga0395901_0211057_471_1013 164
85 3300038443 Ga0395901_1451970 Ga0395901_1451970_25_567 164
86 3300041451 Ga0451791_0442324 Ga0451791_0442324_51_545 164
87 3300041486 Ga0451807_2204000 Ga0451807_2204000_11_505 164
88 3300041505 Ga0451849_1329697 Ga0451849_1329697_19_576 164
89 3300041512 Ga0451853_3047088 Ga0451853_3047088_684_1187 164
90 3300044694 Ga0466963_0001633 Ga0466963_0001633_11074_11568 164
91 3300044694 Ga0466963_0110930 Ga0466963_0110930_592_1128 164
92 3300045976 Ga0466967_0069438 Ga0466967_0069438_743_1237 164
93 3300045976 Ga0466967_0176848 Ga0466967_0176848_1233_1769 164
94 3300046455 Ga0495603_0000389 Ga0495603_0000389_23487_23981 164
95 3300046455 Ga0495603_0013109 Ga0495603_0013109_27_521 164
96 3300046459 Ga0495629_0279332 Ga0495629_0279332_57_551 164
97 3300046459 Ga0495629_0362053 Ga0495629_0362053_156_653 164
98 3300046461 Ga0495641_0403082 Ga0495641_0403082_29_523 164
99 3300046511 Ga0495608_0730667 Ga0495608_0730667_14_511 164
100 3300046516 Ga0495628_0000044 Ga0495628_0000044_9949_10443 164
101 3300046516 Ga0495628_0045802 Ga0495628_0045802_2552_3046 164
102 3300046516 Ga0495628_0373560 Ga0495628_0373560_270_767 164
103 3300046517 Ga0495630_0016974 Ga0495630_0016974_1186_1680 164
104 3300046517 Ga0495630_0326963 Ga0495630_0326963_481_975 164
105 3300046523 Ga0495644_0054721 Ga0495644_0054721_454_996 164
106 3300046529 Ga0495652_0267444 Ga0495652_0267444_666_1160 164
107 3300046529 Ga0495652_0726263 Ga0495652_0726263_25_519 164
108 3300046533 Ga0495640_0734604 Ga0495640_0734604_36_530 164
109 3300046543 Ga0495645_0275269 Ga0495645_0275269_564_1058 164
110 3300046615 Ga0495656_0196021 Ga0495656_0196021_339_881 164
111 3300046642 Ga0495634_0000034 Ga0495634_0000034_26335_26829 164
112 3300046642 Ga0495634_0185923 Ga0495634_0185923_784_1278 164
113 3300046642 Ga0495634_0259943 Ga0495634_0259943_431_925 164
114 3300046663 Ga0495635_0034912 Ga0495635_0034912_259_753 164
115 3300046663 Ga0495635_0548986 Ga0495635_0548986_215_709 164
116 3300046675 Ga0495657_0133349 Ga0495657_0133349_477_971 164
117 3300046681 Ga0495647_0046591 Ga0495647_0046591_97_591 164
118 3300046683 Ga0495658_0518645 Ga0495658_0518645_229_723 164
119 3300046684 Ga0495669_0000580 Ga0495669_0000580_3840_4334 164
120 3300046809 Ga0495600_0365136 Ga0495600_0365136_360_854 164
121 3300046809 Ga0495600_0720557 Ga0495600_0720557_39_536 164
122 3300047322 Ga0495680_0024463 Ga0495680_0024463_2441_2935 164
123 3300047447 Ga0495685_027984 Ga0495685_027984_1397_1891 164
124 3300047471 Ga0495684_0175634 Ga0495684_0175634_104_598 164
125 3300048088 Ga0495602_0003302 Ga0495602_0003302_13203_13697 164
126 3300048905 Ga0496102_1235905 Ga0496102_1235905_38_535 164
127 3300048907 Ga0496104_0000009 Ga0496104_0000009_450570_451064 164
128 3300048908 Ga0496105_0000007 Ga0496105_0000007_36992_37486 164
129 3300048908 Ga0496105_0014548 Ga0496105_0014548_5714_6208 164
130 3300048910 Ga0496107_0376716 Ga0496107_0376716_79_621 164
131 3300048911 Ga0496108_0019027 Ga0496108_0019027_5005_5499 164
132 3300048912 Ga0496109_0284536 Ga0496109_0284536_51_545 164
133 3300048912 Ga0496109_1800736 Ga0496109_1800736_37_534 164
134 3300048913 Ga0496110_0073460 Ga0496110_0073460_192_689 164
135 3300048913 Ga0496110_0116518 Ga0496110_0116518_523_1062 164
136 3300048914 Ga0496111_0249559 Ga0496111_0249559_679_1176 164
137 3300048914 Ga0496111_0662016 Ga0496111_0662016_113_655 164
138 3300048916 Ga0496113_0014270 Ga0496113_0014270_120_614 164
139 3300048916 Ga0496113_0420553 Ga0496113_0420553_533_1030 164
140 3300048917 Ga0496114_0566105 Ga0496114_0566105_118_612 164
141 3300048918 Ga0496115_0017935 Ga0496115_0017935_4901_5395 164
142 3300049459 Ga0495678_215181 Ga0495678_215181_13_555 164
143 3300049578 Ga0501042_0447477 Ga0501042_0447477_181_675 164
144 3300049590 Ga0501074_0633060 Ga0501074_0633060_143_685 164
145 3300049591 Ga0501075_0371424 Ga0501075_0371424_238_732 164
146 3300049592 Ga0501076_0490955 Ga0501076_0490955_432_926 164
147 3300049743 Ga0501081_0443582 Ga0501081_0443582_63_557 164
148 3300050491 nmdc:mga00v17_56170_c1 nmdc:mga00v17_56170_c1_871_1410 164
149 3300050492 nmdc:mga0yw44_15097_c1 nmdc:mga0yw44_15097_c1_980_1519 164
150 3300050510 nmdc:mga06r32_138267_c1 nmdc:mga06r32_138267_c1_970_1512 164
151 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_706_1200 164
152 3300053077 Ga0495601_0001717 Ga0495601_0001717_1314_1808 164
153 3300053077 Ga0495601_0059234 Ga0495601_0059234_1369_1866 164
154 3300053078 Ga0495612_0000955 Ga0495612_0000955_4994_5491 164
155 3300053078 Ga0495612_0032819 Ga0495612_0032819_730_1224 164
156 3300053083 Ga0495655_0059967 Ga0495655_0059967_393_935 164
157 3300053084 Ga0495595_0073897 Ga0495595_0073897_1036_1530 164
158 3300053084 Ga0495595_0226578 Ga0495595_0226578_47_544 164
159 3300053084 Ga0495595_0320025 Ga0495595_0320025_266_760 164
160 3300053085 Ga0495619_0000077 Ga0495619_0000077_3064_3558 164
161 3300053085 Ga0495619_0000373 Ga0495619_0000373_14668_15162 164
162 3300053085 Ga0495619_0021136 Ga0495619_0021136_648_1145 164
163 3300053085 Ga0495619_0025542 Ga0495619_0025542_3172_3669 164
164 3300053085 Ga0495619_0135076 Ga0495619_0135076_1023_1517 164
165 3300053085 Ga0495619_1034502 Ga0495619_1034502_22_516 164
166 3300054114 Ga0501084_0389981 Ga0501084_0389981_634_1128 164
167 3300061734 Ga0530510_0238313 Ga0530510_0238313_630_1124 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

41

129

0.91

PF08241

Methyltransf_11

Methyltransferase domain

42

130

0.89

PF13489

Methyltransf_23

Methyltransferase domain

12

131

0.79

PF08242

Methyltransf_12

Methyltransferase domain

42

128

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8988 9 161
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8906 24 133
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8818 26 133
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8705 9 161
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8368 9 161
ID Description Score Start End Superfamily
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8762 9 161 3.40.50.150
af_Q2G1A8_17_252_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8453 23 134 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8223 26 121 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8166 9 161 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.815 28 87 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q7WWT5-F1-model_v4 Methyltransferase domain-containing protein 0.9441 1 164 GO:0008168
AF-A0A1Q7WWT5-F1-model_v4 Methyltransferase domain-containing protein 0.9385 1 164 GO:0008168
AF-A0A164MGI0-F1-model_v4 Methyltransferase domain-containing protein 0.8761 13 133 GO:0030798
GO:0032259
AF-A0A7W0SU16-F1-model_v4 Class I SAM-dependent methyltransferase 0.872 19 154 GO:0008168
GO:0032259
AF-A0A7W6W242-F1-model_v4 deleted 0.8704 17 136

Feature Viewer

pLDDT pTM Quality
88.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map