F254256

General Info

Members Datasets Scaffolds Average Seq Length
169 109 336 127

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101162312|Ga0070706_1011623121
Length 134
Sequence MSRRSVAGVVVDTSVWIDFFAGKGAEELEEALSGGVVILPPIVVAELISGSAGEQRVAVGELLQDAPVHPTPLDHWIRVGDLRRELARKGVVVTIPDSHVAQCALDRDAVLMSRDAVFAQIARHAPLRLHRRIK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
74 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
75 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0.59
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 20.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_101162312 3300005467 Bacteria 710
2 Ga0065707_10204684 3300005295 Unclassified 1294
3 Ga0070690_100087044 3300005330 Bacteria 2051
4 Ga0070690_100119696 3300005330 Unclassified 1766
5 Ga0070666_10230562 3300005335 Bacteria 1308
6 Ga0070680_100379127 3300005336 Bacteria 1204
7 Ga0070692_11066978 3300005345 Bacteria 568
8 Ga0070675_101493115 3300005354 Bacteria 623
9 Ga0070674_100636008 3300005356 Unclassified 905
10 Ga0070709_10000317 3300005434 Bacteria 30644
11 Ga0070713_101021817 3300005436 Unclassified 798
12 Ga0070701_10211309 3300005438 Bacteria 1152
13 Ga0070705_100130979 3300005440 Unclassified 1636
14 Ga0070700_100000158 3300005441 Bacteria 39651
15 Ga0070700_100258451 3300005441 Bacteria 1253
16 Ga0070694_100054433 3300005444 Bacteria 2711
17 Ga0070708_100039153 3300005445 Bacteria 4146
18 Ga0070708_100233099 3300005445 Bacteria 1728
19 Ga0070708_100265273 3300005445 Bacteria 1615
20 Ga0070708_100934436 3300005445 Bacteria 814
21 Ga0070706_100006023 3300005467 Bacteria 11462
22 Ga0070706_100093769 3300005467 Bacteria 2786
23 Ga0070706_100478664 3300005467 Bacteria 1158
24 Ga0070707_100011248 3300005468 Bacteria 8342
25 Ga0070707_100064053 3300005468 Bacteria 3529
26 Ga0070707_100810127 3300005468 Unclassified 900
27 Ga0070707_101198833 3300005468 Bacteria 725
28 Ga0070698_100017815 3300005471 Bacteria 7481
29 Ga0070698_100027659 3300005471 Bacteria 5896
30 Ga0070698_100076804 3300005471 Bacteria 3341
31 Ga0070698_100126007 3300005471 Bacteria 2518
32 Ga0070698_100811288 3300005471 Bacteria 880
33 Ga0070699_100001211 3300005518 Bacteria 23846
34 Ga0070699_100050628 3300005518 Bacteria 3597
35 Ga0070699_100064359 3300005518 Bacteria 3181
36 Ga0070699_100120289 3300005518 Unclassified 2309
37 Ga0070699_101801294 3300005518 Bacteria 560
38 Ga0070697_100642927 3300005536 Bacteria 934
39 Ga0070697_100649727 3300005536 Bacteria 929
40 Ga0070697_100908884 3300005536 Unclassified 781
41 Ga0070697_101001293 3300005536 Bacteria 743
42 Ga0070686_100700786 3300005544 Unclassified 808
43 Ga0070696_100070940 3300005546 Unclassified 2451
44 Ga0070704_100017148 3300005549 Bacteria 4597
45 Ga0068857_100114068 3300005577 Bacteria 2430
46 Ga0068854_100353641 3300005578 Bacteria 1203
47 Ga0070702_101569224 3300005615 Unclassified 544
48 Ga0068859_100418953 3300005617 Bacteria 1435
49 Ga0068864_101459134 3300005618 Bacteria 687
50 Ga0068858_100835098 3300005842 Bacteria 899
51 Ga0068860_100218701 3300005843 Unclassified 1849
52 Ga0068860_100295378 3300005843 Bacteria 1586
53 Ga0068860_101629752 3300005843 Bacteria 667
54 Ga0068862_100397007 3300005844 Unclassified 1289
55 Ga0068862_100618821 3300005844 Unclassified 1041
56 Ga0081455_10010776 3300005937 Bacteria 9237
57 Ga0070716_100705348 3300006173 Bacteria 771
58 Ga0070716_101138093 3300006173 Unclassified 624
59 Ga0068871_100682009 3300006358 Unclassified 940
60 Ga0075428_100786923 3300006844 Bacteria 1011
61 Ga0075434_100684662 3300006871 Bacteria 1043
62 Ga0075434_102084797 3300006871 Unclassified 572
63 Ga0075436_100000492 3300006914 Bacteria 25525
64 Ga0075436_100021538 3300006914 Bacteria 4425
65 Ga0097620_100418974 3300006931 Bacteria 1435
66 Ga0075435_100000060 3300007076 Bacteria 55995
67 Ga0075435_100269763 3300007076 Bacteria 1451
68 Ga0075435_100918841 3300007076 Bacteria 763
69 Ga0111539_12157100 3300009094 Unclassified 646
70 Ga0114129_10113540 3300009147 Bacteria 3735
71 Ga0105241_11324221 3300009174 Bacteria 687
72 Ga0105248_10334933 3300009177 Bacteria 1704
73 Ga0105248_11216767 3300009177 Bacteria 852
74 Ga0105249_10464225 3300009553 Unclassified 1306
75 Ga0105249_10470843 3300009553 Bacteria 1298
76 Ga0105249_12571149 3300009553 Unclassified 581
77 Ga0105246_10113938 3300011119 Bacteria 1991
78 Ga0163162_10081165 3300013306 Bacteria 3313
79 Ga0163162_10767408 3300013306 Unclassified 1083
80 Ga0157375_10000008 3300013308 Bacteria 373560
81 Ga0157380_13399145 3300014326 Bacteria 509
82 Ga0157379_10331879 3300014968 Bacteria 1390
83 Ga0157379_10721243 3300014968 Bacteria 937
84 Ga0213876_10334616 3300021384 Bacteria 805
85 Ga0207653_10254732 3300025885 Bacteria 673
86 Ga0207680_10337780 3300025903 Unclassified 1056
87 Ga0207699_10000067 3300025906 Bacteria 82866
88 Ga0207684_10022872 3300025910 Bacteria 5337
89 Ga0207684_10185907 3300025910 Bacteria 1792
90 Ga0207684_10513905 3300025910 Unclassified 1026
91 Ga0207660_10711904 3300025917 Bacteria 819
92 Ga0207646_10046493 3300025922 Bacteria 3894
93 Ga0207646_10930129 3300025922 Unclassified 770
94 Ga0207700_10421924 3300025928 Unclassified 1172
95 Ga0207665_10809720 3300025939 Bacteria 740
96 Ga0207712_10070391 3300025961 Bacteria 2513
97 Ga0207640_10716103 3300025981 Bacteria 860
98 Ga0207708_10000007 3300026075 Bacteria 264612
99 Ga0207708_10218526 3300026075 Bacteria 1526
100 Ga0207641_10104938 3300026088 Bacteria 2496
101 Ga0207676_10726210 3300026095 Bacteria 964
102 Ga0207674_10152191 3300026116 Bacteria 2270
103 Ga0207675_100115008 3300026118 Bacteria 2541
104 Ga0207428_10038178 3300027907 Bacteria 3905
105 Ga0268265_10124622 3300028380 Bacteria 2129
106 Ga0268264_10169223 3300028381 Bacteria 1975
107 Ga0268264_10761946 3300028381 Bacteria 965
108 Ga0268264_11452991 3300028381 Bacteria 696
109 Ga0373941_0193072 3300035115 Unclassified 770
110 Ga0373931_0191055 3300035691 Bacteria 1218
111 Ga0373937_2096590 3300036401 Unclassified 511
112 Ga0436365_0829456 3300039437 Bacteria 2373
113 Ga0451807_1352431 3300041486 Unclassified 1697
114 Ga0451835_0770937 3300041492 Bacteria 596
115 Ga0450908_055468 3300042184 Bacteria 692
116 Ga0450918_038951 3300042531 Unclassified 850
117 Ga0453683_0383908 3300044673 Unclassified 904
118 Ga0451576_0991089 3300045051 Bacteria 881
119 Ga0495620_0001555 3300046515 Bacteria 13633
120 Ga0495679_010151 3300047446 Bacteria 3717
121 Ga0501031_0432605 3300049568 Unclassified 850
122 Ga0501033_1172167 3300049570 Bacteria 509
123 Ga0501036_0017857 3300049572 Bacteria 5939
124 Ga0501038_0094512 3300049574 Bacteria 2499
125 Ga0501040_0013644 3300049576 Bacteria 5343
126 Ga0501040_0147983 3300049576 Bacteria 1656
127 Ga0501041_0010926 3300049577 Bacteria 5359
128 Ga0501041_0195822 3300049577 Bacteria 1266
129 Ga0501041_0224139 3300049577 Bacteria 1180
130 Ga0501046_0054387 3300049580 Bacteria 3149
131 Ga0501068_0041900 3300049584 Bacteria 2753
132 Ga0501070_0250811 3300049586 Bacteria 1448
133 Ga0501071_0040507 3300049587 Bacteria 3333
134 Ga0501072_0191612 3300049588 Bacteria 1630
135 Ga0501073_0165069 3300049589 Bacteria 1534
136 Ga0501074_0011202 3300049590 Bacteria 6514
137 Ga0501075_0016265 3300049591 Bacteria 5356
138 Ga0501075_0024322 3300049591 Bacteria 4440
139 Ga0501075_0329896 3300049591 Bacteria 1163
140 Ga0501076_0015200 3300049592 Bacteria 5814
141 Ga0501076_0391727 3300049592 Bacteria 1142
142 Ga0501076_1714821 3300049592 Bacteria 515
143 Ga0501077_0065616 3300049593 Bacteria 2302
144 Ga0501079_0112807 3300049741 Unclassified 2113
145 Ga0501079_0136259 3300049741 Bacteria 1911
146 Ga0501080_0040517 3300049742 Bacteria 4344
147 Ga0501080_0746534 3300049742 Bacteria 861
148 Ga0501081_0011811 3300049743 Bacteria 5720
149 Ga0501081_0149531 3300049743 Bacteria 1677
150 Ga0501081_1231051 3300049743 Bacteria 567
151 Ga0501083_0232444 3300049744 Bacteria 1201
152 Ga0501045_0047249 3300049824 Bacteria 3135
153 Ga0501045_0266316 3300049824 Unclassified 1276
154 Ga0501045_0552780 3300049824 Unclassified 854
155 Ga0501045_1192304 3300049824 Bacteria 556
156 nmdc:mga05p37_1648683_c1 3300050507 Bacteria 629
157 nmdc:mga08y16_107870_c1 3300050511 Bacteria 2899
158 nmdc:mga0n895_1857365_c1 3300050512 Unclassified 562
159 nmdc:mga0n895_601513_c1 3300050512 Bacteria 1102
160 nmdc:mga0rr50_122848_c1 3300050513 Bacteria 2069
161 nmdc:mga0rr50_631_c1 3300050513 Bacteria 18915
162 nmdc:mga08x19_288_c1 3300050514 Bacteria 37103
163 nmdc:mga08x19_857_c2 3300050514 Bacteria 11541
164 Ga0500635_0137259 3300053080 Bacteria 926
165 Ga0501084_0019699 3300054114 Bacteria 5621
166 Ga0501082_0015138 3300060353 Bacteria 6646
167 Ga0530510_0023478 3300061734 Bacteria 4395
168 Ga0530510_0108000 3300061734 Bacteria 2037
169 Ga0070706_101162312
170 Ga0065707_10204684
171 Ga0070690_100087044
172 Ga0070690_100119696
173 Ga0070666_10230562
174 Ga0070680_100379127
175 Ga0070692_11066978
176 Ga0070675_101493115
177 Ga0070674_100636008
178 Ga0070709_10000317
179 Ga0070713_101021817
180 Ga0070701_10211309
181 Ga0070705_100130979
182 Ga0070700_100000158
183 Ga0070700_100258451
184 Ga0070694_100054433
185 Ga0070708_100039153
186 Ga0070708_100233099
187 Ga0070708_100265273
188 Ga0070708_100934436
189 Ga0070706_100006023
190 Ga0070706_100093769
191 Ga0070706_100478664
192 Ga0070707_100011248
193 Ga0070707_100064053
194 Ga0070707_100810127
195 Ga0070707_101198833
196 Ga0070698_100017815
197 Ga0070698_100027659
198 Ga0070698_100076804
199 Ga0070698_100126007
200 Ga0070698_100811288
201 Ga0070699_100001211
202 Ga0070699_100050628
203 Ga0070699_100064359
204 Ga0070699_100120289
205 Ga0070699_101801294
206 Ga0070697_100642927
207 Ga0070697_100649727
208 Ga0070697_100908884
209 Ga0070697_101001293
210 Ga0070686_100700786
211 Ga0070696_100070940
212 Ga0070704_100017148
213 Ga0068857_100114068
214 Ga0068854_100353641
215 Ga0070702_101569224
216 Ga0068859_100418953
217 Ga0068864_101459134
218 Ga0068858_100835098
219 Ga0068860_100218701
220 Ga0068860_100295378
221 Ga0068860_101629752
222 Ga0068862_100397007
223 Ga0068862_100618821
224 Ga0081455_10010776
225 Ga0070716_100705348
226 Ga0070716_101138093
227 Ga0068871_100682009
228 Ga0075428_100786923
229 Ga0075434_100684662
230 Ga0075434_102084797
231 Ga0075436_100000492
232 Ga0075436_100021538
233 Ga0097620_100418974
234 Ga0075435_100000060
235 Ga0075435_100269763
236 Ga0075435_100918841
237 Ga0111539_12157100
238 Ga0114129_10113540
239 Ga0105241_11324221
240 Ga0105248_10334933
241 Ga0105248_11216767
242 Ga0105249_10464225
243 Ga0105249_10470843
244 Ga0105249_12571149
245 Ga0105246_10113938
246 Ga0163162_10081165
247 Ga0163162_10767408
248 Ga0157375_10000008
249 Ga0157380_13399145
250 Ga0157379_10331879
251 Ga0157379_10721243
252 Ga0213876_10334616
253 Ga0207653_10254732
254 Ga0207680_10337780
255 Ga0207699_10000067
256 Ga0207684_10022872
257 Ga0207684_10185907
258 Ga0207684_10513905
259 Ga0207660_10711904
260 Ga0207646_10046493
261 Ga0207646_10930129
262 Ga0207700_10421924
263 Ga0207665_10809720
264 Ga0207712_10070391
265 Ga0207640_10716103
266 Ga0207708_10000007
267 Ga0207708_10218526
268 Ga0207641_10104938
269 Ga0207676_10726210
270 Ga0207674_10152191
271 Ga0207675_100115008
272 Ga0207428_10038178
273 Ga0268265_10124622
274 Ga0268264_10169223
275 Ga0268264_10761946
276 Ga0268264_11452991
277 Ga0373941_0193072
278 Ga0373931_0191055
279 Ga0373937_2096590
280 Ga0436365_0829456
281 Ga0451807_1352431
282 Ga0451835_0770937
283 Ga0450908_055468
284 Ga0450918_038951
285 Ga0453683_0383908
286 Ga0451576_0991089
287 Ga0495620_0001555
288 Ga0495679_010151
289 Ga0501031_0432605
290 Ga0501033_1172167
291 Ga0501036_0017857
292 Ga0501038_0094512
293 Ga0501040_0013644
294 Ga0501040_0147983
295 Ga0501041_0010926
296 Ga0501041_0195822
297 Ga0501041_0224139
298 Ga0501046_0054387
299 Ga0501068_0041900
300 Ga0501070_0250811
301 Ga0501071_0040507
302 Ga0501072_0191612
303 Ga0501073_0165069
304 Ga0501074_0011202
305 Ga0501075_0016265
306 Ga0501075_0024322
307 Ga0501075_0329896
308 Ga0501076_0015200
309 Ga0501076_0391727
310 Ga0501076_1714821
311 Ga0501077_0065616
312 Ga0501079_0112807
313 Ga0501079_0136259
314 Ga0501080_0040517
315 Ga0501080_0746534
316 Ga0501081_0011811
317 Ga0501081_0149531
318 Ga0501081_1231051
319 Ga0501083_0232444
320 Ga0501045_0047249
321 Ga0501045_0266316
322 Ga0501045_0552780
323 Ga0501045_1192304
324 nmdc:mga05p37_1648683_c1
325 nmdc:mga08y16_107870_c1
326 nmdc:mga0n895_1857365_c1
327 nmdc:mga0n895_601513_c1
328 nmdc:mga0rr50_122848_c1
329 nmdc:mga0rr50_631_c1
330 nmdc:mga08x19_288_c1
331 nmdc:mga08x19_857_c2
332 Ga0500635_0137259
333 Ga0501084_0019699
334 Ga0501082_0015138
335 Ga0530510_0023478
336 Ga0530510_0108000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

9

124

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8763 3 126
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8734 3 126
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.8663 3 127
5i27-assembly1.cif.gz_A crystal structure of non-myristoylated mmtv matrix protein 0.8637 73 94
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8516 3 126
ID Description Score Start End Superfamily
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8924 3 126 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8839 4 126 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8668 3 126 3.40.50.1010
3h87A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8541 3 127 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8525 4 126 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A534RP84-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9862 3 126 GO:0000287
GO:0004540
GO:0090729
AF-A0A353EQY1-F1-model_v4 PIN domain nuclease 0.9775 3 126 GO:0004518
AF-A0A2V9LMM9-F1-model_v4 PIN domain-containing protein 0.9639 69 127
AF-A0A7V3FMF0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9615 1 127 GO:0000287
GO:0004540
GO:0090729
AF-A0A537N4H7-F1-model_v4 PIN domain-containing protein 0.9614 63 127

Map