F254686

General Info

Members Datasets Scaffolds Average Seq Length
169 126 338 470

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10027768|Ga0105238_100277683
Length 541
Sequence MAPVAVMASPAAAGDSNVLEVMVSNGMVNRIEDMDRSGVVWKKFYNYNFPAHVRENRGADGLFSAAEWKPEESGLLGPVRLTAVGLRGISNEETGADTVKDSTWTQKVGARPYAFSKKQFFVNNYGAAKDGKTLATRAIQAAIDDCAAKGGGVVVFKPGSYLSGSLFLREGVELRIDKNVTLKGSQHFEDYPLIDTRIAGIEMKWPAALLNIIGVRHAAITGEGLVDAQGKFCWDKYWAMRKVYDPKGLRWIVDYDVQRIRTVLIQRSSDIVVKGIHCQDAGFWTVQVLYSSHVTVDGIVVRNNEHGHGPSTDGVDIDSSTWVLVENCDIDCNDDDFCLKAGRDWDGLRVGKPTEYVVIRNCIARKGGGLLTIGSETSGSIRHVLATNLVAHGTGNGFHIKSATTRGGVVEDIHLRNITMDSVGNAILFTMNWNPAYSYSTLPAGYNADSIPEHWKTLLHRVEPTERGIPHFRDIYISGMKVMSAKNAIVASGLENSLITDVHMNDVRINADDAGEAHFIKDWDLKGVNIVTKNKSTLHIL

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
80 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
81 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
107 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
110 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
111 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
114 2738541278 Niastella sp. CF465 Isolate Unclassified
115 2739367651 Pedobacter sp. OK291 Isolate Unclassified
116 2739367656 Pedobacter sp. CF523 Isolate Unclassified
117 2818991444 Filimonas endophytica 3197 Isolate Unclassified
118 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
119 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
120 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
121 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
122 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
123 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
124 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
125 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
126 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.72
Metatranscriptomes 0
Isolates 8.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.65
Nodule 0
Rhizoplane 0.59
Rhizosphere 77.51
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10027768 3300009551 Bacteria 5767
2 JGI24735J21928_10000001 3300002067 Bacteria 650042
3 JGI25150J39212_1000030 3300002774 Bacteria 101822
4 JGI25151J46595_10000129 3300003187 Bacteria 101822
5 JGI25153J46596_10000096 3300003215 Bacteria 101822
6 rootH1_10015605 3300003316 Bacteria 7520
7 rootH1_10177718 3300003316 Bacteria 1528
8 rootL2_10127439 3300003322 Unclassified 3029
9 Ga0065714_10014702 3300005288 Bacteria 2613
10 Ga0065714_10072698 3300005288 Unclassified 3322
11 Ga0065704_10082087 3300005289 Bacteria 3655
12 Ga0065712_10076605 3300005290 Bacteria 3627
13 Ga0070676_10056883 3300005328 Bacteria 2313
14 Ga0070683_100043648 3300005329 Bacteria 4132
15 Ga0068869_100038900 3300005334 Bacteria 3393
16 Ga0070680_100034337 3300005336 Unclassified 4089
17 Ga0070689_100077304 3300005340 Bacteria 2608
18 Ga0070689_100129271 3300005340 Unclassified 2024
19 Ga0070668_100060790 3300005347 Bacteria 2927
20 Ga0070674_100057194 3300005356 Bacteria 2707
21 Ga0070673_100127412 3300005364 Bacteria 2132
22 Ga0070684_100011884 3300005535 Bacteria 6951
23 Ga0068853_100016945 3300005539 Bacteria 6006
24 Ga0068855_100001476 3300005563 Bacteria 29407
25 Ga0068855_100054986 3300005563 Bacteria 4676
26 Ga0070664_100053307 3300005564 Bacteria 3428
27 Ga0068856_100033832 3300005614 Bacteria 5005
28 Ga0068863_100056454 3300005841 Bacteria 3717
29 Ga0068871_100045062 3300006358 Bacteria 3549
30 Ga0097620_100026084 3300006931 Bacteria 5863
31 Ga0105240_10007373 3300009093 Bacteria 15999
32 Ga0111539_10117667 3300009094 Bacteria 3115
33 Ga0111539_10187970 3300009094 Bacteria 2411
34 Ga0114129_10001095 3300009147 Bacteria 35580
35 Ga0105242_10002149 3300009176 Bacteria 15569
36 Ga0105242_10010534 3300009176 Bacteria 7099
37 Ga0105237_10000287 3300009545 Bacteria 69624
38 Ga0105237_10029061 3300009545 Bacteria 5623
39 Ga0105249_10003237 3300009553 Bacteria 14106
40 Ga0105239_10000619 3300010375 Bacteria 50485
41 Ga0105239_10006240 3300010375 Bacteria 13861
42 Ga0157371_10001240 3300013102 Bacteria 27027
43 Ga0157371_10022189 3300013102 Bacteria 4655
44 Ga0157370_10000326 3300013104 Bacteria 59716
45 Ga0157370_10008296 3300013104 Bacteria 11213
46 Ga0157370_10031949 3300013104 Bacteria 5144
47 Ga0157370_10174921 3300013104 Unclassified 1995
48 Ga0157370_10198256 3300013104 Bacteria 1863
49 Ga0157369_10000516 3300013105 Bacteria 50779
50 Ga0157369_10033196 3300013105 Bacteria 5674
51 Ga0157374_10000007 3300013296 Bacteria 595643
52 Ga0163162_10001221 3300013306 Bacteria 23991
53 Ga0163162_10350589 3300013306 Unclassified 1609
54 Ga0157372_10000010 3300013307 Bacteria 300658
55 Ga0157372_10001002 3300013307 Bacteria 30836
56 Ga0157372_10014376 3300013307 Bacteria 8464
57 Ga0157372_10033681 3300013307 Bacteria 5629
58 Ga0157372_10060146 3300013307 Bacteria 4251
59 Ga0157375_10089056 3300013308 Bacteria 3142
60 Ga0157380_10013931 3300014326 Bacteria 5873
61 Ga0157376_10002407 3300014969 Bacteria 12640
62 Ga0157376_10009200 3300014969 Bacteria 7166
63 Ga0182006_1000507 3300015261 Bacteria 29690
64 Ga0163161_10000524 3300017792 Bacteria 31293
65 Ga0207425_1000004 3300025245 Bacteria 1092421
66 Ga0209129_1000314 3300025258 Bacteria 43196
67 Ga0209025_1000009 3300025294 Bacteria 1092561
68 Ga0209758_1000010 3300025297 Bacteria 1092782
69 Ga0207647_10019928 3300025904 Bacteria 4504
70 Ga0207647_10031237 3300025904 Bacteria 3428
71 Ga0207645_10104752 3300025907 Bacteria 1827
72 Ga0207695_10000406 3300025913 Bacteria 95981
73 Ga0207671_10001256 3300025914 Bacteria 29879
74 Ga0207671_10081289 3300025914 Bacteria 2430
75 Ga0207652_10000525 3300025921 Bacteria 38942
76 Ga0207650_10048488 3300025925 Bacteria 3133
77 Ga0207650_10091541 3300025925 Bacteria 2324
78 Ga0207659_10098524 3300025926 Unclassified 2198
79 Ga0207686_10000546 3300025934 Bacteria 24296
80 Ga0207670_10203631 3300025936 Bacteria 1505
81 Ga0207689_10011074 3300025942 Bacteria 7750
82 Ga0207661_10025510 3300025944 Bacteria 4494
83 Ga0207667_10000407 3300025949 Bacteria 58389
84 Ga0207667_10002056 3300025949 Bacteria 25225
85 Ga0207651_10082632 3300025960 Bacteria 2320
86 Ga0207712_10011829 3300025961 Bacteria 5563
87 Ga0207703_10058599 3300026035 Bacteria 3144
88 Ga0207678_10024195 3300026067 Bacteria 5305
89 Ga0207702_10051805 3300026078 Bacteria 3471
90 Ga0207641_10073255 3300026088 Bacteria 2951
91 Ga0207648_10003963 3300026089 Bacteria 15385
92 Ga0207698_10148456 3300026142 Bacteria 2031
93 Ga0307515_10000002 3300028794 Bacteria 1231751
94 Ga0307511_10004810 3300030521 Bacteria 13809
95 Ga0265327_10000701 3300031251 Bacteria 53104
96 Ga0307509_10050564 3300031507 Bacteria 4449
97 Ga0307509_10119183 3300031507 Bacteria 2621
98 Ga0307508_10003423 3300031616 Bacteria 16055
99 Ga0307516_10001627 3300031730 Bacteria 30950
100 Ga0307510_10003136 3300033180 Bacteria 19151
101 Ga0395899_0000405 3300037312 Bacteria 50426
102 Ga0395899_0054892 3300037312 Bacteria 2947
103 Ga0395900_0079718 3300037418 Bacteria 3365
104 Ga0395900_0119611 3300037418 Bacteria 2703
105 Ga0395900_0279874 3300037418 Bacteria 1660
106 Ga0395898_0055850 3300037466 Unclassified 3851
107 Ga0439457_003287 3300042014 Bacteria 4428
108 Ga0439462_0009634 3300042015 Bacteria 2442
109 Ga0450894_006488 3300042131 Unclassified 1510
110 Ga0451577_0003273 3300042876 Bacteria 18229
111 Ga0466972_0000008 3300044658 Bacteria 264518
112 Ga0466972_0000099 3300044658 Bacteria 76709
113 Ga0466972_0006058 3300044658 Bacteria 6075
114 Ga0453684_0004093 3300044712 Bacteria 31634
115 Ga0466957_0002079 3300044842 Bacteria 10710
116 Ga0466957_0002228 3300044842 Bacteria 10392
117 Ga0466959_0006106 3300045049 Bacteria 8319
118 Ga0495650_0000025 3300046471 Bacteria 486001
119 Ga0495585_0000290 3300046492 Bacteria 50496
120 Ga0495606_0000110 3300046507 Bacteria 139007
121 Ga0495606_0012712 3300046507 Bacteria 6714
122 Ga0495606_0085423 3300046507 Bacteria 1952
123 Ga0495610_0000096 3300046512 Bacteria 102012
124 Ga0495610_0000275 3300046512 Bacteria 53769
125 Ga0495648_0077948 3300046524 Bacteria 1897
126 Ga0495668_0000670 3300046616 Bacteria 41268
127 Ga0495668_0001253 3300046616 Bacteria 25423
128 Ga0495611_0000089 3300046648 Bacteria 63663
129 Ga0495625_0000008 3300046660 Bacteria 536165
130 Ga0495625_0004143 3300046660 Bacteria 13830
131 Ga0495625_0005791 3300046660 Bacteria 11163
132 Ga0495661_0001208 3300046665 Bacteria 22408
133 Ga0495649_0000006 3300046694 Bacteria 542188
134 Ga0495672_0008897 3300047320 Bacteria 7341
135 Ga0495687_001433 3300047443 Bacteria 21941
136 Ga0495686_0000663 3300047472 Bacteria 46787
137 Ga0495686_0001676 3300047472 Bacteria 23028
138 Ga0495686_0100124 3300047472 Bacteria 1749
139 Ga0501047_0030081 3300049581 Bacteria 5236
140 Ga0501044_0022057 3300049823 Bacteria 6790
141 Ga0501044_0022785 3300049823 Bacteria 6670
142 nmdc:mga05p37_5369_c1 3300050507 Bacteria 15069
143 nmdc:mga08y16_123404_c1 3300050511 Bacteria 2695
144 Ga0500578_0006670 3300053086 Bacteria 7689
145 Ga0500644_0007787 3300053088 Bacteria 2802
146 Ga0500583_0000150 3300053092 Bacteria 29240
147 Ga0500583_0048730 3300053092 Bacteria 1957
148 Ga0500562_000028 3300053108 Bacteria 95758
149 Ga0500562_005795 3300053108 Bacteria 3110
150 Ga0500616_0001824 3300053153 Bacteria 19305
151 Ga0500616_0015458 3300053153 Bacteria 4363
152 Ga0500622_0004357 3300053156 Bacteria 8940
153 Ga0500624_000661 3300053157 Bacteria 8946
154 Ga0500639_039535 3300053163 Bacteria 2483
155 Ga0466962_0021399 3300061719 Bacteria 3106
156 2599477441 2599185184 Bacteria 6430550
157 2738729831 2738541278 Bacteria 9755573
158 2739590224 2739367651 Bacteria 6359826
159 2739616278 2739367656 Bacteria 5152243
160 2819587819 2818991444 Bacteria 6968812
161 2833641197 2833640130 Bacteria 4858325
162 2857631740 2857627736 Bacteria 5625397
163 2928079354 2928078545 Bacteria 6534839
164 2928148165 2928147474 Bacteria 6512076
165 2929158145 2929154850 Bacteria 6753285
166 2932084056 2932082852 Bacteria 6563563
167 2946000009 2945997725 Bacteria 6404843
168 2954016609 2954016120 Bacteria 6446024
169 2977235276 2977232053 Bacteria 5485925
170 Ga0105238_10027768
171 JGI24735J21928_10000001
172 JGI25150J39212_1000030
173 JGI25151J46595_10000129
174 JGI25153J46596_10000096
175 rootH1_10015605
176 rootH1_10177718
177 rootL2_10127439
178 Ga0065714_10014702
179 Ga0065714_10072698
180 Ga0065704_10082087
181 Ga0065712_10076605
182 Ga0070676_10056883
183 Ga0070683_100043648
184 Ga0068869_100038900
185 Ga0070680_100034337
186 Ga0070689_100077304
187 Ga0070689_100129271
188 Ga0070668_100060790
189 Ga0070674_100057194
190 Ga0070673_100127412
191 Ga0070684_100011884
192 Ga0068853_100016945
193 Ga0068855_100001476
194 Ga0068855_100054986
195 Ga0070664_100053307
196 Ga0068856_100033832
197 Ga0068863_100056454
198 Ga0068871_100045062
199 Ga0097620_100026084
200 Ga0105240_10007373
201 Ga0111539_10117667
202 Ga0111539_10187970
203 Ga0114129_10001095
204 Ga0105242_10002149
205 Ga0105242_10010534
206 Ga0105237_10000287
207 Ga0105237_10029061
208 Ga0105249_10003237
209 Ga0105239_10000619
210 Ga0105239_10006240
211 Ga0157371_10001240
212 Ga0157371_10022189
213 Ga0157370_10000326
214 Ga0157370_10008296
215 Ga0157370_10031949
216 Ga0157370_10174921
217 Ga0157370_10198256
218 Ga0157369_10000516
219 Ga0157369_10033196
220 Ga0157374_10000007
221 Ga0163162_10001221
222 Ga0163162_10350589
223 Ga0157372_10000010
224 Ga0157372_10001002
225 Ga0157372_10014376
226 Ga0157372_10033681
227 Ga0157372_10060146
228 Ga0157375_10089056
229 Ga0157380_10013931
230 Ga0157376_10002407
231 Ga0157376_10009200
232 Ga0182006_1000507
233 Ga0163161_10000524
234 Ga0207425_1000004
235 Ga0209129_1000314
236 Ga0209025_1000009
237 Ga0209758_1000010
238 Ga0207647_10019928
239 Ga0207647_10031237
240 Ga0207645_10104752
241 Ga0207695_10000406
242 Ga0207671_10001256
243 Ga0207671_10081289
244 Ga0207652_10000525
245 Ga0207650_10048488
246 Ga0207650_10091541
247 Ga0207659_10098524
248 Ga0207686_10000546
249 Ga0207670_10203631
250 Ga0207689_10011074
251 Ga0207661_10025510
252 Ga0207667_10000407
253 Ga0207667_10002056
254 Ga0207651_10082632
255 Ga0207712_10011829
256 Ga0207703_10058599
257 Ga0207678_10024195
258 Ga0207702_10051805
259 Ga0207641_10073255
260 Ga0207648_10003963
261 Ga0207698_10148456
262 Ga0307515_10000002
263 Ga0307511_10004810
264 Ga0265327_10000701
265 Ga0307509_10050564
266 Ga0307509_10119183
267 Ga0307508_10003423
268 Ga0307516_10001627
269 Ga0307510_10003136
270 Ga0395899_0000405
271 Ga0395899_0054892
272 Ga0395900_0079718
273 Ga0395900_0119611
274 Ga0395900_0279874
275 Ga0395898_0055850
276 Ga0439457_003287
277 Ga0439462_0009634
278 Ga0450894_006488
279 Ga0451577_0003273
280 Ga0466972_0000008
281 Ga0466972_0000099
282 Ga0466972_0006058
283 Ga0453684_0004093
284 Ga0466957_0002079
285 Ga0466957_0002228
286 Ga0466959_0006106
287 Ga0495650_0000025
288 Ga0495585_0000290
289 Ga0495606_0000110
290 Ga0495606_0012712
291 Ga0495606_0085423
292 Ga0495610_0000096
293 Ga0495610_0000275
294 Ga0495648_0077948
295 Ga0495668_0000670
296 Ga0495668_0001253
297 Ga0495611_0000089
298 Ga0495625_0000008
299 Ga0495625_0004143
300 Ga0495625_0005791
301 Ga0495661_0001208
302 Ga0495649_0000006
303 Ga0495672_0008897
304 Ga0495687_001433
305 Ga0495686_0000663
306 Ga0495686_0001676
307 Ga0495686_0100124
308 Ga0501047_0030081
309 Ga0501044_0022057
310 Ga0501044_0022785
311 nmdc:mga05p37_5369_c1
312 nmdc:mga08y16_123404_c1
313 Ga0500578_0006670
314 Ga0500644_0007787
315 Ga0500583_0000150
316 Ga0500583_0048730
317 Ga0500562_000028
318 Ga0500562_005795
319 Ga0500616_0001824
320 Ga0500616_0015458
321 Ga0500622_0004357
322 Ga0500624_000661
323 Ga0500639_039535
324 Ga0466962_0021399
325 2599477441
326 2738729831
327 2739590224
328 2739616278
329 2819587819
330 2833641197
331 2857631740
332 2928079354
333 2928148165
334 2929158145
335 2932084056
336 2946000009
337 2954016609
338 2977235276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00295

Glyco_hydro_28

Glycosyl hydrolases family 28

152

446

0.87

PF12708

Pectate_lyase_3

Pectate lyase superfamily protein

119

338

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mxn-assembly3.cif.gz_C crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8629 58 303
4mxn-assembly4.cif.gz_D crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8597 57 303
4mxn-assembly2.cif.gz_B crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8475 57 303
4mxn-assembly3.cif.gz_C crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.837 58 303
4mxn-assembly4.cif.gz_D crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8193 57 303
ID Description Score Start End Superfamily
af_I1MS92_65_454_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8601 55 480 2.160.20.10
af_Q0DX16_1_247_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8571 198 483 2.160.20.10
af_Q0DX16_1_247_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.851 198 483 2.160.20.10
af_A3BCJ3_1_229_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8499 150 375 2.160.20.10
af_I1JIZ6_20_275_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8472 158 424 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A5M8NXW7-F1-model_v4 Exo-poly-alpha-D-galacturonosidase (EC 3.2.1.82) 0.9902 74 217 GO:0004557
GO:0033917
AF-A0A4Q3DNV2-F1-model_v4 Glycoside hydrolase family 28 protein 0.9877 41 482 GO:0004650
GO:0005975
AF-A0A380B951-F1-model_v4 Exo-poly-alpha-D-galacturonosidase (EC 3.2.1.82) 0.9852 84 482 GO:0004650
GO:0005975
GO:0033917
AF-A0A519Z2Z8-F1-model_v4 Glycoside hydrolase family 28 protein 0.9818 150 482 GO:0004650
GO:0005975
AF-A0A519Z863-F1-model_v4 Glycoside hydrolase family 28 protein 0.9815 137 483 GO:0004650
GO:0005975

Map