F255177

General Info

Members Datasets Scaffolds Average Seq Length
169 54 169 160

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_251383|Ga0400483_251383_28084_28668
Length 194
Sequence VKGSVFYAGGNWSKLYVQYSGSKGRHFTILVTWMRIGQGYDAHRFGSGKSLVIGGIVVPHDQGLQAHSDGDVLIHALCDALLGAAGLGDIGGHFPDTDPVYAGIDSRVLLRQVMVRVGEDGFRLSNADMTIVAQRPKLAPYIESMRRCLAEDLQLHEQRINIKATTTEGMGFTGRGEGIAALATVLLEEPRIDR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
3 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
4 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
5 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
6 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
7 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
8 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
9 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
10 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
11 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
12 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
13 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
17 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
18 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
19 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
20 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
21 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
22 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
23 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
24 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
25 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
26 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
27 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
28 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
31 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
32 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
33 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
34 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
35 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
36 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
37 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
38 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
39 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
40 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
42 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
43 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
44 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
45 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
46 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
47 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
48 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
49 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
50 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
52 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
53 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
54 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 6.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 28.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10130777 3300003323 Bacteria 9742
2 Ga0207699_10813503 3300025906 Bacteria 687
3 Ga0307513_10000272 3300031456 Bacteria 75284
4 Ga0316575_10000385 3300031665 Bacteria 12582
5 Ga0316575_10001560 3300031665 Bacteria 7437
6 Ga0316579_10000973 3300031691 Bacteria 10022
7 Ga0316579_10001889 3300031691 Bacteria 7785
8 Ga0316579_10008217 3300031691 Bacteria 4342
9 Ga0316579_10015270 3300031691 Bacteria 3331
10 Ga0316579_10049376 3300031691 Bacteria 1966
11 Ga0316579_10422084 3300031691 Bacteria 645
12 Ga0316576_10001053 3300031727 Bacteria 14312
13 Ga0316576_10040578 3300031727 Bacteria 3346
14 Ga0316576_10075955 3300031727 Bacteria 2486
15 Ga0316576_10218653 3300031727 Bacteria 1433
16 Ga0316576_10219463 3300031727 Bacteria 1430
17 Ga0316576_10300169 3300031727 Bacteria 1200
18 Ga0316578_10000767 3300031728 Bacteria 11792
19 Ga0316578_10018696 3300031728 Bacteria 3802
20 Ga0316578_10024311 3300031728 Bacteria 3398
21 Ga0316578_10047311 3300031728 Bacteria 2509
22 Ga0316578_10077596 3300031728 Bacteria 1972
23 Ga0316578_10119847 3300031728 Bacteria 1581
24 Ga0316578_10241401 3300031728 Bacteria 1085
25 Ga0316577_10004130 3300031733 Bacteria 7454
26 Ga0316577_10006897 3300031733 Bacteria 6034
27 Ga0316577_10014467 3300031733 Bacteria 4331
28 Ga0316577_10101526 3300031733 Bacteria 1612
29 Ga0316577_10127919 3300031733 Bacteria 1429
30 Ga0316577_10133324 3300031733 Bacteria 1398
31 Ga0307414_10150041 3300032004 Bacteria 1838
32 Ga0316583_10063025 3300032133 Bacteria 1299
33 Ga0316583_10063199 3300032133 Bacteria 1297
34 Ga0316583_10083140 3300032133 Bacteria 1118
35 Ga0316585_10000628 3300032137 Bacteria 8692
36 Ga0316585_10077546 3300032137 Bacteria 1081
37 Ga0316580_10000338 3300032139 Bacteria 10298
38 Ga0316580_10006073 3300032139 Bacteria 3549
39 Ga0316580_10019637 3300032139 Bacteria 2080
40 Ga0316580_10019973 3300032139 Bacteria 2061
41 Ga0316593_10009797 3300032168 Bacteria 2722
42 Ga0316593_10010489 3300032168 Unclassified 2658
43 Ga0316593_10022256 3300032168 Bacteria 1990
44 Ga0316593_10083645 3300032168 Bacteria 1117
45 Ga0316593_10159091 3300032168 Bacteria 824
46 Ga0316593_10184852 3300032168 Bacteria 767
47 Ga0316592_1037575 3300033524 Bacteria 1066
48 Ga0316592_1076600 3300033524 Bacteria 759
49 Ga0316596_1000703 3300033541 Bacteria 6076
50 Ga0316596_1003536 3300033541 Bacteria 3437
51 Ga0316596_1011576 3300033541 Unclassified 2158
52 Ga0316574_0000838 3300035398 Bacteria 13430
53 Ga0316574_0001102 3300035398 Bacteria 12371
54 Ga0316574_0328267 3300035398 Bacteria 970
55 Ga0316574_0382757 3300035398 Bacteria 887
56 Ga0316574_0842833 3300035398 Bacteria 556
57 Ga0316582_0000538 3300036647 Bacteria 14444
58 Ga0316582_0026070 3300036647 Bacteria 3516
59 Ga0316582_0043442 3300036647 Bacteria 2819
60 Ga0316582_0079940 3300036647 Bacteria 2133
61 Ga0316582_0102574 3300036647 Bacteria 1896
62 Ga0316582_0266672 3300036647 Bacteria 1174
63 Ga0316582_0331678 3300036647 Bacteria 1046
64 Ga0316584_0001823 3300036712 Bacteria 13173
65 Ga0316584_0003101 3300036712 Bacteria 10726
66 Ga0316584_0034193 3300036712 Bacteria 3768
67 Ga0316584_0088971 3300036712 Bacteria 2312
68 Ga0316584_0110769 3300036712 Unclassified 2054
69 Ga0316584_0127121 3300036712 Bacteria 1903
70 Ga0316584_0205542 3300036712 Bacteria 1451
71 Ga0316581_0002742 3300037588 Bacteria 4272
72 Ga0316581_0012543 3300037588 Bacteria 2387
73 Ga0316581_0036572 3300037588 Bacteria 1490
74 Ga0400484_06098 3300038725 Bacteria 7825
75 Ga0400484_15735 3300038725 Bacteria 52349
76 Ga0400484_17160 3300038725 Bacteria 3673
77 Ga0400484_23745 3300038725 Bacteria 1244
78 Ga0400484_41503 3300038725 Bacteria 3711
79 Ga0400490_04645 3300038726 Bacteria 12637
80 Ga0400490_31544 3300038726 Bacteria 1266
81 Ga0400490_32268 3300038726 Bacteria 35545
82 Ga0400491_16887 3300038727 Bacteria 2652
83 Ga0400485_16102 3300038735 Bacteria 3160
84 Ga0400485_19410 3300038735 Bacteria 5224
85 Ga0400488_00481 3300038741 Unclassified 2444
86 Ga0400488_11780 3300038741 Unclassified 3386
87 Ga0400488_13493 3300038741 Bacteria 2364
88 Ga0400488_51145 3300038741 Bacteria 4527
89 Ga0400488_52795 3300038741 Bacteria 4474
90 Ga0400486_05347 3300038742 Bacteria 4994
91 Ga0400486_06751 3300038742 Bacteria 16566
92 Ga0400483_000383 3300039062 Bacteria 6178
93 Ga0400483_006417 3300039062 Bacteria 18976
94 Ga0400483_009419 3300039062 Bacteria 9938
95 Ga0400483_012200 3300039062 Unclassified 1386
96 Ga0400483_026308 3300039062 Bacteria 223136
97 Ga0400483_034748 3300039062 Unclassified 1043
98 Ga0400483_044050 3300039062 Bacteria 7150
99 Ga0400483_078235 3300039062 Bacteria 1373
100 Ga0400483_104332 3300039062 Bacteria 1848
101 Ga0400483_130942 3300039062 Bacteria 1863
102 Ga0400483_215349 3300039062 Bacteria 8579
103 Ga0400483_235487 3300039062 Unclassified 1520
104 Ga0400483_242915 3300039062 Bacteria 8100
105 Ga0400483_247565 3300039062 Bacteria 3018
106 Ga0400483_249363 3300039062 Bacteria 6451
107 Ga0400483_250036 3300039062 Bacteria 396353
108 Ga0400483_251383 3300039062 Bacteria 55523
109 Ga0400483_278627 3300039062 Unclassified 2915
110 Ga0400483_281644 3300039062 Bacteria 8396
111 Ga0400483_291193 3300039062 Bacteria 5042
112 Ga0400487_03724 3300039110 Unclassified 2092
113 Ga0400487_24619 3300039110 Bacteria 1540
114 Ga0400487_25945 3300039110 Bacteria 95730
115 Ga0400487_41681 3300039110 Bacteria 1097
116 Ga0400487_53319 3300039110 Bacteria 2136
117 Ga0400487_55848 3300039110 Bacteria 3502
118 Ga0400487_59347 3300039110 Bacteria 4104
119 Ga0400487_61541 3300039110 Bacteria 1138
120 Ga0451807_2070195 3300041486 Bacteria 525
121 Ga0451577_0000999 3300042876 Bacteria 41097
122 Ga0451577_0027029 3300042876 Bacteria 5195
123 Ga0451577_0066065 3300042876 Bacteria 3226
124 Ga0451577_0095797 3300042876 Bacteria 2650
125 Ga0451577_0484023 3300042876 Bacteria 1123
126 Ga0451577_1618922 3300042876 Bacteria 571
127 Ga0453683_0000482 3300044673 Bacteria 45741
128 Ga0453683_0003630 3300044673 Bacteria 11310
129 Ga0453683_0040842 3300044673 Bacteria 2912
130 Ga0453684_0000051 3300044712 Bacteria 551033
131 Ga0453684_0000264 3300044712 Bacteria 225672
132 Ga0453684_0001730 3300044712 Bacteria 58478
133 Ga0453684_0002153 3300044712 Bacteria 49330
134 Ga0453684_0017315 3300044712 Bacteria 11175
135 Ga0453684_0028002 3300044712 Bacteria 8057
136 Ga0453684_0029340 3300044712 Bacteria 7814
137 Ga0453684_0034957 3300044712 Bacteria 6958
138 Ga0453684_0100675 3300044712 Unclassified 3536
139 Ga0453684_0286990 3300044712 Bacteria 1875
140 Ga0453684_0827630 3300044712 Bacteria 996
141 Ga0451576_0000148 3300045051 Bacteria 178544
142 Ga0451576_0000860 3300045051 Bacteria 58751
143 Ga0451576_0010544 3300045051 Bacteria 10590
144 Ga0451576_0036954 3300045051 Bacteria 5175
145 Ga0451576_0065266 3300045051 Bacteria 3791
146 Ga0501033_0003546 3300049570 Bacteria 12763
147 Ga0501034_0012572 3300049571 Bacteria 8738
148 Ga0501036_0055323 3300049572 Bacteria 3361
149 Ga0501037_0002476 3300049573 Bacteria 13336
150 Ga0501038_0030620 3300049574 Bacteria 4759
151 Ga0501039_0117558 3300049575 Bacteria 2082
152 Ga0501043_0023578 3300049579 Bacteria 4826
153 Ga0501046_0139422 3300049580 Bacteria 1836
154 Ga0501047_0168955 3300049581 Bacteria 2056
155 Ga0501047_0450120 3300049581 Bacteria 1117
156 Ga0501048_1159351 3300049582 Bacteria 556
157 Ga0501067_0024491 3300049583 Bacteria 3348
158 Ga0501068_0023754 3300049584 Bacteria 3595
159 Ga0501072_0259664 3300049588 Bacteria 1383
160 Ga0501073_0011418 3300049589 Bacteria 6499
161 Ga0501074_0402237 3300049590 Bacteria 971
162 Ga0501080_0002489 3300049742 Bacteria 16121
163 Ga0501080_0014481 3300049742 Bacteria 7264
164 Ga0501083_0019407 3300049744 Bacteria 4737
165 Ga0501035_0056658 3300049822 Bacteria 3496
166 Ga0501044_0001571 3300049823 Bacteria 26728
167 nmdc:mga0a205_515734_c1 3300050515 Bacteria 1052
168 Ga0501084_0510010 3300054114 Bacteria 1017
169 Ga0501082_0074484 3300060353 Bacteria 2924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10000272 Ga0307513_1000027222 154
2 3300031665 Ga0316575_10000385 Ga0316575_100003855 156
3 3300031691 Ga0316579_10015270 Ga0316579_100152705 156
4 3300031691 Ga0316579_10049376 Ga0316579_100493762 156
5 3300031691 Ga0316579_10422084 Ga0316579_104220841 156
6 3300031727 Ga0316576_10040578 Ga0316576_100405784 156
7 3300031727 Ga0316576_10218653 Ga0316576_102186532 156
8 3300031727 Ga0316576_10219463 Ga0316576_102194632 156
9 3300031728 Ga0316578_10000767 Ga0316578_100007679 156
10 3300031728 Ga0316578_10018696 Ga0316578_100186962 156
11 3300031728 Ga0316578_10077596 Ga0316578_100775962 156
12 3300031733 Ga0316577_10101526 Ga0316577_101015262 156
13 3300031733 Ga0316577_10133324 Ga0316577_101333242 156
14 3300032133 Ga0316583_10083140 Ga0316583_100831402 156
15 3300032137 Ga0316585_10000628 Ga0316585_100006285 156
16 3300032139 Ga0316580_10000338 Ga0316580_100003382 156
17 3300032139 Ga0316580_10019973 Ga0316580_100199732 156
18 3300032168 Ga0316593_10009797 Ga0316593_100097974 156
19 3300032168 Ga0316593_10083645 Ga0316593_100836452 156
20 3300032168 Ga0316593_10159091 Ga0316593_101590912 156
21 3300033524 Ga0316592_1037575 Ga0316592_10375752 156
22 3300033524 Ga0316592_1076600 Ga0316592_10766002 156
23 3300033541 Ga0316596_1000703 Ga0316596_10007032 156
24 3300033541 Ga0316596_1003536 Ga0316596_10035364 156
25 3300033541 Ga0316596_1011576 Ga0316596_10115763 156
26 3300035398 Ga0316574_0000838 Ga0316574_0000838_2361_2831 156
27 3300036647 Ga0316582_0102574 Ga0316582_0102574_171_641 156
28 3300036712 Ga0316584_0001823 Ga0316584_0001823_8533_9003 156
29 3300036712 Ga0316584_0034193 Ga0316584_0034193_1438_1908 156
30 3300036712 Ga0316584_0088971 Ga0316584_0088971_822_1292 156
31 3300036712 Ga0316584_0205542 Ga0316584_0205542_341_811 156
32 3300038725 Ga0400484_17160 Ga0400484_17160_305_775 156
33 3300038725 Ga0400484_23745 Ga0400484_23745_116_586 156
34 3300038741 Ga0400488_00481 Ga0400488_00481_1357_1827 156
35 3300038741 Ga0400488_13493 Ga0400488_13493_787_1257 156
36 3300039062 Ga0400483_012200 Ga0400483_012200_155_625 156
37 3300039062 Ga0400483_026308 Ga0400483_026308_172626_173114 156
38 3300039062 Ga0400483_034748 Ga0400483_034748_90_560 156
39 3300039062 Ga0400483_078235 Ga0400483_078235_792_1262 156
40 3300039062 Ga0400483_104332 Ga0400483_104332_244_714 156
41 3300039062 Ga0400483_235487 Ga0400483_235487_151_621 156
42 3300039062 Ga0400483_247565 Ga0400483_247565_1345_1815 156
43 3300039062 Ga0400483_250036 Ga0400483_250036_379232_379720 156
44 3300039062 Ga0400483_281644 Ga0400483_281644_5533_6003 156
45 3300039110 Ga0400487_59347 Ga0400487_59347_17_487 156
46 3300044712 Ga0453684_0017315 Ga0453684_0017315_9146_9616 156
47 3300044712 Ga0453684_0286990 Ga0453684_0286990_555_1025 156
48 3300003323 rootH1_10130777 rootH1_101307776 157
49 3300025906 Ga0207699_10813503 Ga0207699_108135031 157
50 3300031665 Ga0316575_10001560 Ga0316575_100015606 157
51 3300031691 Ga0316579_10000973 Ga0316579_100009739 157
52 3300031691 Ga0316579_10001889 Ga0316579_100018892 157
53 3300031691 Ga0316579_10008217 Ga0316579_100082174 157
54 3300031727 Ga0316576_10001053 Ga0316576_100010535 157
55 3300031727 Ga0316576_10075955 Ga0316576_100759554 157
56 3300031727 Ga0316576_10300169 Ga0316576_103001692 157
57 3300031728 Ga0316578_10024311 Ga0316578_100243115 157
58 3300031728 Ga0316578_10047311 Ga0316578_100473112 157
59 3300031728 Ga0316578_10119847 Ga0316578_101198473 157
60 3300031728 Ga0316578_10241401 Ga0316578_102414012 157
61 3300031733 Ga0316577_10004130 Ga0316577_100041308 157
62 3300031733 Ga0316577_10006897 Ga0316577_100068976 157
63 3300031733 Ga0316577_10014467 Ga0316577_100144674 157
64 3300031733 Ga0316577_10127919 Ga0316577_101279192 157
65 3300032004 Ga0307414_10150041 Ga0307414_101500414 157
66 3300032133 Ga0316583_10063025 Ga0316583_100630252 157
67 3300032133 Ga0316583_10063199 Ga0316583_100631991 157
68 3300032137 Ga0316585_10077546 Ga0316585_100775462 157
69 3300032139 Ga0316580_10006073 Ga0316580_100060732 157
70 3300032139 Ga0316580_10019637 Ga0316580_100196374 157
71 3300032168 Ga0316593_10010489 Ga0316593_100104892 157
72 3300032168 Ga0316593_10022256 Ga0316593_100222562 157
73 3300032168 Ga0316593_10184852 Ga0316593_101848522 157
74 3300035398 Ga0316574_0001102 Ga0316574_0001102_1165_1662 157
75 3300035398 Ga0316574_0328267 Ga0316574_0328267_55_537 157
76 3300035398 Ga0316574_0382757 Ga0316574_0382757_25_519 157
77 3300035398 Ga0316574_0842833 Ga0316574_0842833_48_524 157
78 3300036647 Ga0316582_0000538 Ga0316582_0000538_9678_10160 157
79 3300036647 Ga0316582_0026070 Ga0316582_0026070_502_975 157
80 3300036647 Ga0316582_0043442 Ga0316582_0043442_1803_2294 157
81 3300036647 Ga0316582_0079940 Ga0316582_0079940_282_770 157
82 3300036647 Ga0316582_0266672 Ga0316582_0266672_256_738 157
83 3300036647 Ga0316582_0331678 Ga0316582_0331678_225_722 157
84 3300036712 Ga0316584_0003101 Ga0316584_0003101_965_1438 157
85 3300036712 Ga0316584_0110769 Ga0316584_0110769_177_659 157
86 3300036712 Ga0316584_0127121 Ga0316584_0127121_976_1467 157
87 3300037588 Ga0316581_0002742 Ga0316581_0002742_1640_2122 157
88 3300037588 Ga0316581_0012543 Ga0316581_0012543_1567_2049 157
89 3300037588 Ga0316581_0036572 Ga0316581_0036572_550_1041 157
90 3300038725 Ga0400484_06098 Ga0400484_06098_3741_4226 157
91 3300038725 Ga0400484_15735 Ga0400484_15735_44519_45001 157
92 3300038725 Ga0400484_41503 Ga0400484_41503_495_980 157
93 3300038726 Ga0400490_04645 Ga0400490_04645_1715_2197 157
94 3300038726 Ga0400490_31544 Ga0400490_31544_478_960 157
95 3300038726 Ga0400490_32268 Ga0400490_32268_27313_27798 157
96 3300038727 Ga0400491_16887 Ga0400491_16887_1683_2165 157
97 3300038735 Ga0400485_16102 Ga0400485_16102_399_881 157
98 3300038735 Ga0400485_19410 Ga0400485_19410_4533_5018 157
99 3300038741 Ga0400488_11780 Ga0400488_11780_2853_3338 157
100 3300038741 Ga0400488_51145 Ga0400488_51145_462_944 157
101 3300038741 Ga0400488_52795 Ga0400488_52795_743_1225 157
102 3300038742 Ga0400486_05347 Ga0400486_05347_4222_4707 157
103 3300038742 Ga0400486_06751 Ga0400486_06751_6564_7049 157
104 3300039062 Ga0400483_000383 Ga0400483_000383_2898_3395 157
105 3300039062 Ga0400483_006417 Ga0400483_006417_14551_15036 157
106 3300039062 Ga0400483_009419 Ga0400483_009419_5681_6163 157
107 3300039062 Ga0400483_044050 Ga0400483_044050_1093_1575 157
108 3300039062 Ga0400483_130942 Ga0400483_130942_143_625 157
109 3300039062 Ga0400483_215349 Ga0400483_215349_1235_1717 157
110 3300039062 Ga0400483_242915 Ga0400483_242915_4574_5059 157
111 3300039062 Ga0400483_249363 Ga0400483_249363_5681_6163 157
112 3300039062 Ga0400483_251383 Ga0400483_251383_28084_28668 157
113 3300039062 Ga0400483_278627 Ga0400483_278627_198_686 157
114 3300039062 Ga0400483_291193 Ga0400483_291193_4105_4587 157
115 3300039110 Ga0400487_03724 Ga0400487_03724_288_773 157
116 3300039110 Ga0400487_24619 Ga0400487_24619_921_1403 157
117 3300039110 Ga0400487_25945 Ga0400487_25945_23584_24066 157
118 3300039110 Ga0400487_41681 Ga0400487_41681_453_938 157
119 3300039110 Ga0400487_53319 Ga0400487_53319_548_1033 157
120 3300039110 Ga0400487_55848 Ga0400487_55848_2482_2964 157
121 3300039110 Ga0400487_61541 Ga0400487_61541_583_1068 157
122 3300041486 Ga0451807_2070195 Ga0451807_2070195_33_506 157
123 3300042876 Ga0451577_0000999 Ga0451577_0000999_27470_27952 157
124 3300042876 Ga0451577_0027029 Ga0451577_0027029_3005_3487 157
125 3300042876 Ga0451577_0066065 Ga0451577_0066065_1823_2308 157
126 3300042876 Ga0451577_0095797 Ga0451577_0095797_1030_1512 157
127 3300042876 Ga0451577_0484023 Ga0451577_0484023_206_685 157
128 3300042876 Ga0451577_1618922 Ga0451577_1618922_62_538 157
129 3300044673 Ga0453683_0000482 Ga0453683_0000482_45048_45536 157
130 3300044673 Ga0453683_0003630 Ga0453683_0003630_4316_4804 157
131 3300044673 Ga0453683_0040842 Ga0453683_0040842_888_1370 157
132 3300044712 Ga0453684_0000051 Ga0453684_0000051_30481_30963 157
133 3300044712 Ga0453684_0000264 Ga0453684_0000264_196871_197353 157
134 3300044712 Ga0453684_0001730 Ga0453684_0001730_57785_58273 157
135 3300044712 Ga0453684_0002153 Ga0453684_0002153_43954_44433 157
136 3300044712 Ga0453684_0028002 Ga0453684_0028002_6192_6674 157
137 3300044712 Ga0453684_0029340 Ga0453684_0029340_5969_6451 157
138 3300044712 Ga0453684_0034957 Ga0453684_0034957_2626_3108 157
139 3300044712 Ga0453684_0100675 Ga0453684_0100675_248_727 157
140 3300044712 Ga0453684_0827630 Ga0453684_0827630_356_841 157
141 3300045051 Ga0451576_0000148 Ga0451576_0000148_128260_128742 157
142 3300045051 Ga0451576_0000860 Ga0451576_0000860_58058_58546 157
143 3300045051 Ga0451576_0010544 Ga0451576_0010544_4363_4842 157
144 3300045051 Ga0451576_0036954 Ga0451576_0036954_1915_2400 157
145 3300045051 Ga0451576_0065266 Ga0451576_0065266_1841_2323 157
146 3300049570 Ga0501033_0003546 Ga0501033_0003546_7254_7733 157
147 3300049571 Ga0501034_0012572 Ga0501034_0012572_6685_7164 157
148 3300049572 Ga0501036_0055323 Ga0501036_0055323_703_1182 157
149 3300049573 Ga0501037_0002476 Ga0501037_0002476_5019_5498 157
150 3300049574 Ga0501038_0030620 Ga0501038_0030620_1577_2056 157
151 3300049575 Ga0501039_0117558 Ga0501039_0117558_1572_2051 157
152 3300049579 Ga0501043_0023578 Ga0501043_0023578_1227_1706 157
153 3300049580 Ga0501046_0139422 Ga0501046_0139422_1341_1820 157
154 3300049581 Ga0501047_0168955 Ga0501047_0168955_1012_1491 157
155 3300049581 Ga0501047_0450120 Ga0501047_0450120_86_565 157
156 3300049582 Ga0501048_1159351 Ga0501048_1159351_29_511 157
157 3300049583 Ga0501067_0024491 Ga0501067_0024491_103_582 157
158 3300049584 Ga0501068_0023754 Ga0501068_0023754_1583_2062 157
159 3300049588 Ga0501072_0259664 Ga0501072_0259664_50_529 157
160 3300049589 Ga0501073_0011418 Ga0501073_0011418_1214_1693 157
161 3300049590 Ga0501074_0402237 Ga0501074_0402237_417_896 157
162 3300049742 Ga0501080_0002489 Ga0501080_0002489_15625_16104 157
163 3300049742 Ga0501080_0014481 Ga0501080_0014481_71_550 157
164 3300049744 Ga0501083_0019407 Ga0501083_0019407_3420_3899 157
165 3300049822 Ga0501035_0056658 Ga0501035_0056658_805_1284 157
166 3300049823 Ga0501044_0001571 Ga0501044_0001571_884_1363 157
167 3300050515 nmdc:mga0a205_515734_c1 nmdc:mga0a205_515734_c1_215_733 157
168 3300054114 Ga0501084_0510010 Ga0501084_0510010_410_889 157
169 3300060353 Ga0501082_0074484 Ga0501082_0074484_1060_1539 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

34

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b8f-assembly1.cif.gz_B x-ray crystal structure of a 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from pseudomonas aeruginosa 0.999 2 157
5l12-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9917 2 154
3ieq-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine 0.9906 2 154
1t0a-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis 0.9905 2 157
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9899 2 154
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9833 2 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9801 2 157 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9715 2 157 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.971 2 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9678 2 157 3.30.1330.50
ID Description Score Start End GO Terms
AF-Q21LB9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.003 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-C1DSS0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.002 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A3L8B0D0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A4R6ZIV1-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 2 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2D5QFP7-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map