F256236

General Info

Members Datasets Scaffolds Average Seq Length
170 126 340 191

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000092|Ga0070713_10000009214
Length 216
Sequence MSRRGRAIGFLFGALLAAAAXXTIANGYGDSVVRGYGELRPVLVASGDLEAGKAIDPAIATEKLEVRRVPVRFVPPDALAAPAEAVGLVPAVSVPAGSYLLAAQLRAPEAHPLGAQLGGGRRPVEITVSGAGALAAFGARPVGAKVDVVVTTEPSGSGDGRTYVAAPAVPLLELGPGPEGPDGETATATLGLTRAQALRLIAAESFARRVTVIPRG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100000092 3300005436 Bacteria 57390
2 Ga0070658_10257192 3300005327 Bacteria 1482
3 Ga0070683_100000304 3300005329 Bacteria 33703
4 Ga0070683_100003719 3300005329 Bacteria 12438
5 Ga0070683_100009164 3300005329 Bacteria 8449
6 Ga0070690_100232356 3300005330 Bacteria 1297
7 Ga0070677_10000080 3300005333 Bacteria 30587
8 Ga0070666_10086738 3300005335 Bacteria 2145
9 Ga0070682_100000017 3300005337 Bacteria 235228
10 Ga0070682_100000049 3300005337 Bacteria 127229
11 Ga0068868_100000026 3300005338 Bacteria 81980
12 Ga0070689_100168607 3300005340 Bacteria 1773
13 Ga0070661_100000199 3300005344 Bacteria 49733
14 Ga0070669_100058627 3300005353 Bacteria 2826
15 Ga0070675_100000025 3300005354 Bacteria 115134
16 Ga0070674_100139479 3300005356 Bacteria 1818
17 Ga0070673_100025990 3300005364 Bacteria 4318
18 Ga0070688_100000149 3300005365 Bacteria 37792
19 Ga0070659_100001957 3300005366 Bacteria 14721
20 Ga0070659_100005063 3300005366 Bacteria 9448
21 Ga0070713_100110519 3300005436 Bacteria 2396
22 Ga0070711_100413773 3300005439 Bacteria 1097
23 Ga0070678_100013421 3300005456 Bacteria 5136
24 Ga0070685_10000024 3300005466 Bacteria 101602
25 Ga0070685_10114891 3300005466 Bacteria 1664
26 Ga0070684_100002617 3300005535 Bacteria 13300
27 Ga0070684_100020862 3300005535 Bacteria 5439
28 Ga0070684_100355763 3300005535 Bacteria 1347
29 Ga0070684_100472178 3300005535 Unclassified 1160
30 Ga0068853_100003511 3300005539 Bacteria 11992
31 Ga0068853_100237898 3300005539 Bacteria 1668
32 Ga0070672_100000025 3300005543 Bacteria 67313
33 Ga0070696_100477325 3300005546 Unclassified 988
34 Ga0070665_100003670 3300005548 Bacteria 16268
35 Ga0070665_100308796 3300005548 Bacteria 1585
36 Ga0068855_100068773 3300005563 Bacteria 4122
37 Ga0068854_100003838 3300005578 Bacteria 9413
38 Ga0068854_100013679 3300005578 Bacteria 5332
39 Ga0068856_100024539 3300005614 Bacteria 5870
40 Ga0068852_100020855 3300005616 Bacteria 5216
41 Ga0068864_100000031 3300005618 Bacteria 215331
42 Ga0068866_10094862 3300005718 Bacteria 1633
43 Ga0068858_100000009 3300005842 Bacteria 237748
44 Ga0068858_100000284 3300005842 Bacteria 54715
45 Ga0070712_100005336 3300006175 Bacteria 7957
46 Ga0105245_10000179 3300009098 Bacteria 60347
47 Ga0105245_10014695 3300009098 Bacteria 6816
48 Ga0105247_10023099 3300009101 Bacteria 3745
49 Ga0105241_10182931 3300009174 Bacteria 1740
50 Ga0105242_10100673 3300009176 Bacteria 2448
51 Ga0105248_10000008 3300009177 Bacteria 403910
52 Ga0105249_10602481 3300009553 Unclassified 1153
53 Ga0157374_10007122 3300013296 Bacteria 9526
54 Ga0157378_10001054 3300013297 Bacteria 25233
55 Ga0157378_10010088 3300013297 Bacteria 8235
56 Ga0157372_10008018 3300013307 Bacteria 11233
57 Ga0157375_10009995 3300013308 Bacteria 8340
58 Ga0163163_10157941 3300014325 Bacteria 2312
59 Ga0163163_10252770 3300014325 Unclassified 1813
60 Ga0157380_10000037 3300014326 Bacteria 80856
61 Ga0206353_11131953 3300020082 Bacteria 1533
62 Ga0207682_10000045 3300025893 Bacteria 51744
63 Ga0207642_10006561 3300025899 Bacteria 3879
64 Ga0207710_10020608 3300025900 Unclassified 2820
65 Ga0207680_10039185 3300025903 Bacteria 2748
66 Ga0207705_10098466 3300025909 Bacteria 2149
67 Ga0207654_10311332 3300025911 Bacteria 1073
68 Ga0207693_10009829 3300025915 Bacteria 7784
69 Ga0207663_10408778 3300025916 Unclassified 1039
70 Ga0207649_10000009 3300025920 Bacteria 295544
71 Ga0207681_10082816 3300025923 Bacteria 2269
72 Ga0207659_10000033 3300025926 Bacteria 113729
73 Ga0207687_10000609 3300025927 Bacteria 24091
74 Ga0207687_10005615 3300025927 Bacteria 8292
75 Ga0207700_10000007 3300025928 Bacteria 345720
76 Ga0207700_10132243 3300025928 Bacteria 2039
77 Ga0207690_10043841 3300025932 Bacteria 2946
78 Ga0207686_10380843 3300025934 Bacteria 1070
79 Ga0207691_10000135 3300025940 Bacteria 67302
80 Ga0207711_10000006 3300025941 Bacteria 792692
81 Ga0207661_10000056 3300025944 Bacteria 85250
82 Ga0207661_10000986 3300025944 Bacteria 18816
83 Ga0207661_10003365 3300025944 Bacteria 11111
84 Ga0207667_10056853 3300025949 Bacteria 4108
85 Ga0207712_10070543 3300025961 Bacteria 2510
86 Ga0207640_10000225 3300025981 Bacteria 39704
87 Ga0207640_10002332 3300025981 Bacteria 10205
88 Ga0207677_10000106 3300026023 Bacteria 68108
89 Ga0207703_10000018 3300026035 Bacteria 271377
90 Ga0207703_10000207 3300026035 Bacteria 68866
91 Ga0207639_10002631 3300026041 Bacteria 12052
92 Ga0207702_10007336 3300026078 Bacteria 9418
93 Ga0207676_10000031 3300026095 Bacteria 215877
94 Ga0207683_10040054 3300026121 Bacteria 4087
95 Ga0207698_10002365 3300026142 Bacteria 11183
96 Ga0268266_10000047 3300028379 Bacteria 310996
97 Ga0268266_10002714 3300028379 Bacteria 18561
98 Ga0268266_10258751 3300028379 Bacteria 1612
99 Ga0268266_11410028 3300028379 Unclassified 672
100 Ga0307415_100009525 3300032126 Bacteria 5451
101 Ga0373937_0340452 3300036401 Bacteria 1420
102 Ga0466963_0131805 3300044694 Unclassified 1727
103 Ga0466967_0013813 3300045976 Bacteria 6260
104 Ga0495592_0000494 3300046454 Bacteria 28719
105 Ga0495592_0082287 3300046454 Bacteria 2327
106 Ga0495629_0000145 3300046459 Bacteria 61915
107 Ga0495629_0421125 3300046459 Bacteria 906
108 Ga0495582_0000004 3300046473 Bacteria 168322
109 Ga0495662_0137647 3300046476 Bacteria 1201
110 Ga0495594_0000010 3300046499 Bacteria 118481
111 Ga0495606_0000072 3300046507 Bacteria 173678
112 Ga0495608_0000023 3300046511 Bacteria 160090
113 Ga0495608_0000080 3300046511 Bacteria 71060
114 Ga0495620_0000820 3300046515 Bacteria 19163
115 Ga0495628_0077859 3300046516 Bacteria 2579
116 Ga0495628_0107755 3300046516 Bacteria 2145
117 Ga0495644_0003485 3300046523 Bacteria 6225
118 Ga0495652_0473410 3300046529 Unclassified 873
119 Ga0495587_0003597 3300046536 Bacteria 10320
120 Ga0495621_0003088 3300046539 Bacteria 4548
121 Ga0495645_0477147 3300046543 Bacteria 783
122 Ga0495622_0000104 3300046557 Bacteria 73828
123 Ga0495667_0120103 3300046559 Bacteria 1697
124 Ga0495634_0000034 3300046642 Bacteria 106338
125 Ga0495634_0001636 3300046642 Bacteria 19506
126 Ga0495634_0037330 3300046642 Bacteria 3320
127 Ga0495588_0000244 3300046674 Bacteria 45880
128 Ga0495657_0000020 3300046675 Bacteria 160089
129 Ga0495658_0000004 3300046683 Bacteria 173598
130 Ga0495613_0000251 3300046689 Bacteria 50730
131 Ga0495604_0000106 3300047317 Bacteria 69765
132 Ga0495604_0003919 3300047317 Bacteria 11849
133 Ga0495672_0081870 3300047320 Unclassified 1796
134 Ga0495676_0002352 3300047321 Bacteria 16760
135 Ga0495680_0000183 3300047322 Bacteria 66401
136 Ga0495680_0000447 3300047322 Bacteria 46180
137 Ga0495675_0000506 3300047444 Bacteria 25254
138 Ga0495679_006203 3300047446 Bacteria 5184
139 Ga0495602_0000142 3300048088 Bacteria 66941
140 Ga0496100_0000005 3300048903 Bacteria 312112
141 Ga0496101_0000022 3300048904 Bacteria 216728
142 Ga0496104_0044610 3300048907 Bacteria 4166
143 Ga0496104_0329464 3300048907 Bacteria 1440
144 Ga0496105_0032391 3300048908 Bacteria 4288
145 Ga0496106_0001128 3300048909 Bacteria 19755
146 Ga0496107_0000011 3300048910 Bacteria 201631
147 Ga0496108_0002235 3300048911 Bacteria 15513
148 Ga0496108_0024200 3300048911 Bacteria 5000
149 Ga0496109_0001590 3300048912 Bacteria 18943
150 Ga0496110_0000240 3300048913 Bacteria 35546
151 Ga0496110_0040984 3300048913 Bacteria 4038
152 Ga0496111_0000355 3300048914 Bacteria 22710
153 Ga0496112_0000013 3300048915 Bacteria 237194
154 Ga0496112_0486213 3300048915 Bacteria 1171
155 Ga0496113_0000090 3300048916 Bacteria 39733
156 Ga0496113_0756964 3300048916 Bacteria 773
157 Ga0501072_0067044 3300049588 Bacteria 2832
158 Ga0501045_0082369 3300049824 Bacteria 2373
159 Ga0495601_0000027 3300053077 Bacteria 116790
160 Ga0495601_0000066 3300053077 Bacteria 56855
161 Ga0495601_0063738 3300053077 Bacteria 2343
162 Ga0495601_0156279 3300053077 Bacteria 1489
163 Ga0495612_0005804 3300053078 Bacteria 5097
164 Ga0495655_0000478 3300053083 Bacteria 6692
165 Ga0495595_0000022 3300053084 Bacteria 110598
166 Ga0495595_0003370 3300053084 Bacteria 6343
167 Ga0495619_0000008 3300053085 Bacteria 305999
168 Ga0495619_0000152 3300053085 Bacteria 51090
169 Ga0495619_0000222 3300053085 Bacteria 41071
170 Ga0501082_0285435 3300060353 Bacteria 1437
171 Ga0070713_100000092
172 Ga0070658_10257192
173 Ga0070683_100000304
174 Ga0070683_100003719
175 Ga0070683_100009164
176 Ga0070690_100232356
177 Ga0070677_10000080
178 Ga0070666_10086738
179 Ga0070682_100000017
180 Ga0070682_100000049
181 Ga0068868_100000026
182 Ga0070689_100168607
183 Ga0070661_100000199
184 Ga0070669_100058627
185 Ga0070675_100000025
186 Ga0070674_100139479
187 Ga0070673_100025990
188 Ga0070688_100000149
189 Ga0070659_100001957
190 Ga0070659_100005063
191 Ga0070713_100110519
192 Ga0070711_100413773
193 Ga0070678_100013421
194 Ga0070685_10000024
195 Ga0070685_10114891
196 Ga0070684_100002617
197 Ga0070684_100020862
198 Ga0070684_100355763
199 Ga0070684_100472178
200 Ga0068853_100003511
201 Ga0068853_100237898
202 Ga0070672_100000025
203 Ga0070696_100477325
204 Ga0070665_100003670
205 Ga0070665_100308796
206 Ga0068855_100068773
207 Ga0068854_100003838
208 Ga0068854_100013679
209 Ga0068856_100024539
210 Ga0068852_100020855
211 Ga0068864_100000031
212 Ga0068866_10094862
213 Ga0068858_100000009
214 Ga0068858_100000284
215 Ga0070712_100005336
216 Ga0105245_10000179
217 Ga0105245_10014695
218 Ga0105247_10023099
219 Ga0105241_10182931
220 Ga0105242_10100673
221 Ga0105248_10000008
222 Ga0105249_10602481
223 Ga0157374_10007122
224 Ga0157378_10001054
225 Ga0157378_10010088
226 Ga0157372_10008018
227 Ga0157375_10009995
228 Ga0163163_10157941
229 Ga0163163_10252770
230 Ga0157380_10000037
231 Ga0206353_11131953
232 Ga0207682_10000045
233 Ga0207642_10006561
234 Ga0207710_10020608
235 Ga0207680_10039185
236 Ga0207705_10098466
237 Ga0207654_10311332
238 Ga0207693_10009829
239 Ga0207663_10408778
240 Ga0207649_10000009
241 Ga0207681_10082816
242 Ga0207659_10000033
243 Ga0207687_10000609
244 Ga0207687_10005615
245 Ga0207700_10000007
246 Ga0207700_10132243
247 Ga0207690_10043841
248 Ga0207686_10380843
249 Ga0207691_10000135
250 Ga0207711_10000006
251 Ga0207661_10000056
252 Ga0207661_10000986
253 Ga0207661_10003365
254 Ga0207667_10056853
255 Ga0207712_10070543
256 Ga0207640_10000225
257 Ga0207640_10002332
258 Ga0207677_10000106
259 Ga0207703_10000018
260 Ga0207703_10000207
261 Ga0207639_10002631
262 Ga0207702_10007336
263 Ga0207676_10000031
264 Ga0207683_10040054
265 Ga0207698_10002365
266 Ga0268266_10000047
267 Ga0268266_10002714
268 Ga0268266_10258751
269 Ga0268266_11410028
270 Ga0307415_100009525
271 Ga0373937_0340452
272 Ga0466963_0131805
273 Ga0466967_0013813
274 Ga0495592_0000494
275 Ga0495592_0082287
276 Ga0495629_0000145
277 Ga0495629_0421125
278 Ga0495582_0000004
279 Ga0495662_0137647
280 Ga0495594_0000010
281 Ga0495606_0000072
282 Ga0495608_0000023
283 Ga0495608_0000080
284 Ga0495620_0000820
285 Ga0495628_0077859
286 Ga0495628_0107755
287 Ga0495644_0003485
288 Ga0495652_0473410
289 Ga0495587_0003597
290 Ga0495621_0003088
291 Ga0495645_0477147
292 Ga0495622_0000104
293 Ga0495667_0120103
294 Ga0495634_0000034
295 Ga0495634_0001636
296 Ga0495634_0037330
297 Ga0495588_0000244
298 Ga0495657_0000020
299 Ga0495658_0000004
300 Ga0495613_0000251
301 Ga0495604_0000106
302 Ga0495604_0003919
303 Ga0495672_0081870
304 Ga0495676_0002352
305 Ga0495680_0000183
306 Ga0495680_0000447
307 Ga0495675_0000506
308 Ga0495679_006203
309 Ga0495602_0000142
310 Ga0496100_0000005
311 Ga0496101_0000022
312 Ga0496104_0044610
313 Ga0496104_0329464
314 Ga0496105_0032391
315 Ga0496106_0001128
316 Ga0496107_0000011
317 Ga0496108_0002235
318 Ga0496108_0024200
319 Ga0496109_0001590
320 Ga0496110_0000240
321 Ga0496110_0040984
322 Ga0496111_0000355
323 Ga0496112_0000013
324 Ga0496112_0486213
325 Ga0496113_0000090
326 Ga0496113_0756964
327 Ga0501072_0067044
328 Ga0501045_0082369
329 Ga0495601_0000027
330 Ga0495601_0000066
331 Ga0495601_0063738
332 Ga0495601_0156279
333 Ga0495612_0005804
334 Ga0495655_0000478
335 Ga0495595_0000022
336 Ga0495595_0003370
337 Ga0495619_0000008
338 Ga0495619_0000152
339 Ga0495619_0000222
340 Ga0501082_0285435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08666

SAF

SAF domain

40

106

0.94

Map