F256332

General Info

Members Datasets Scaffolds Average Seq Length
170 111 340 235

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000014|Ga0070699_10000001496
Length 269
Sequence MVPQPLVASAGTIRNHSLHVDAQEDKEVEHKVVSHEDWVVARKKHLVDEKEFTKLRDRLSQARRDLPWELVDKEYVFEGPHGRATLADLFDGRGQLVLYQAMFNPDTAGPSTTWTKDAPCFVCSYWMDNFDRVVVHLNHRDVTMAAVSHAPYPKLAAYSERMGWTFPWYSSVGSDFNFDYHVSFTPEELAAGRAEYNYRVDPISVGSEAPGVSVFTRDDAGRIYHTYSAYARGLDMLNVAYNYLDIVPKGRDEAGVGPMWIHRRDEYPD

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 3.53
Rhizosphere 91.18
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100000014 3300005518 Bacteria 218133
2 JGI25407J50210_10002678 3300003373 Bacteria 4228
3 JGI25407J50210_10054923 3300003373 Bacteria 1006
4 Ga0055536_1006534 3300003781 Bacteria 5418
5 Ga0055530_10008612 3300003791 Bacteria 4049
6 Ga0055540_1002961 3300003792 Bacteria 8527
7 Ga0055531_10005202 3300003794 Bacteria 7655
8 Ga0065715_10179572 3300005293 Bacteria 1486
9 Ga0070690_100066605 3300005330 Unclassified 2332
10 Ga0070690_100072660 3300005330 Bacteria 2237
11 Ga0070670_100031362 3300005331 Bacteria 4577
12 Ga0070689_100721657 3300005340 Bacteria 872
13 Ga0070703_10003649 3300005406 Bacteria 4368
14 Ga0070709_10264314 3300005434 Bacteria 1244
15 Ga0070714_100242764 3300005435 Bacteria 1663
16 Ga0070714_100309525 3300005435 Bacteria 1474
17 Ga0070713_100021283 3300005436 Bacteria 4986
18 Ga0070713_100407968 3300005436 Bacteria 1270
19 Ga0070705_100001750 3300005440 Bacteria 11278
20 Ga0070708_100005958 3300005445 Bacteria 9691
21 Ga0070708_100014959 3300005445 Bacteria 6397
22 Ga0070708_100054001 3300005445 Bacteria 3567
23 Ga0070708_100071411 3300005445 Bacteria 3125
24 Ga0070708_100073117 3300005445 Bacteria 3090
25 Ga0070708_100089185 3300005445 Bacteria 2806
26 Ga0070708_100184336 3300005445 Bacteria 1952
27 Ga0070706_100000342 3300005467 Bacteria 56147
28 Ga0070706_100000347 3300005467 Bacteria 55956
29 Ga0070706_100000937 3300005467 Bacteria 31912
30 Ga0070706_100029546 3300005467 Bacteria 5049
31 Ga0070707_100001550 3300005468 Bacteria 22336
32 Ga0070707_100004658 3300005468 Bacteria 12840
33 Ga0070707_100006879 3300005468 Bacteria 10530
34 Ga0070707_100018258 3300005468 Bacteria 6600
35 Ga0070707_100082182 3300005468 Bacteria 3111
36 Ga0070707_100169410 3300005468 Bacteria 2128
37 Ga0070707_100184140 3300005468 Bacteria 2036
38 Ga0070698_100000448 3300005471 Bacteria 43798
39 Ga0070698_100023332 3300005471 Bacteria 6468
40 Ga0070698_100035087 3300005471 Bacteria 5187
41 Ga0070698_100110347 3300005471 Unclassified 2716
42 Ga0070699_100004649 3300005518 Bacteria 12148
43 Ga0070697_100000001 3300005536 Bacteria 662298
44 Ga0070697_100029082 3300005536 Bacteria 4429
45 Ga0070697_100143641 3300005536 Unclassified 2008
46 Ga0070697_100283942 3300005536 Bacteria 1420
47 Ga0070697_100611136 3300005536 Unclassified 958
48 Ga0068859_101047261 3300005617 Bacteria 897
49 Ga0081455_10005866 3300005937 Bacteria 13352
50 Ga0081455_10066545 3300005937 Bacteria 3009
51 Ga0081538_10002039 3300005981 Bacteria 20160
52 Ga0081538_10002704 3300005981 Bacteria 17054
53 Ga0070717_10000259 3300006028 Bacteria 36157
54 Ga0070717_10000677 3300006028 Bacteria 21967
55 Ga0070717_10007163 3300006028 Bacteria 8264
56 Ga0070717_10023561 3300006028 Bacteria 4880
57 Ga0070716_100167644 3300006173 Bacteria 1430
58 Ga0075430_100012578 3300006846 Bacteria 7206
59 Ga0075433_10024831 3300006852 Bacteria 5063
60 Ga0075436_100013625 3300006914 Bacteria 5569
61 Ga0075436_100319815 3300006914 Bacteria 1115
62 Ga0097620_101047360 3300006931 Bacteria 897
63 Ga0075435_100090621 3300007076 Bacteria 2522
64 Ga0075435_100681858 3300007076 Unclassified 893
65 Ga0111539_10305477 3300009094 Bacteria 1851
66 Ga0105249_10670624 3300009553 Bacteria 1095
67 Ga0157375_10441650 3300013308 Bacteria 1467
68 Ga0197907_10500207 3300020069 Bacteria 1092
69 Ga0209676_1003614 3300025292 Bacteria 9305
70 Ga0209050_1003960 3300025298 Bacteria 10456
71 Ga0209051_1005289 3300025303 Bacteria 7610
72 Ga0209257_1005780 3300025304 Bacteria 8429
73 Ga0207684_10000012 3300025910 Bacteria 478666
74 Ga0207684_10000021 3300025910 Bacteria 340887
75 Ga0207684_10000988 3300025910 Bacteria 31913
76 Ga0207684_10065826 3300025910 Bacteria 3077
77 Ga0207684_10805386 3300025910 Bacteria 794
78 Ga0207693_10264794 3300025915 Bacteria 1347
79 Ga0207646_10000067 3300025922 Bacteria 146410
80 Ga0207646_10001279 3300025922 Bacteria 31477
81 Ga0207646_10007595 3300025922 Bacteria 10984
82 Ga0207646_10070743 3300025922 Bacteria 3116
83 Ga0207646_10130756 3300025922 Bacteria 2259
84 Ga0207646_10272250 3300025922 Bacteria 1530
85 Ga0207646_10274955 3300025922 Bacteria 1522
86 Ga0207700_10033601 3300025928 Bacteria 3672
87 Ga0207700_10758840 3300025928 Bacteria 867
88 Ga0207664_10035472 3300025929 Bacteria 3849
89 Ga0207664_10101969 3300025929 Bacteria 2372
90 Ga0207665_10201155 3300025939 Bacteria 1452
91 Ga0207665_10223275 3300025939 Bacteria 1381
92 Ga0207675_100591982 3300026118 Bacteria 1111
93 Ga0265334_10000022 3300028573 Bacteria 127132
94 Ga0265323_10066103 3300028653 Bacteria 1246
95 Ga0265322_10000697 3300028654 Bacteria 12300
96 Ga0265330_10000292 3300031235 Bacteria 36311
97 Ga0265329_10001170 3300031242 Bacteria 12903
98 Ga0265316_10000459 3300031344 Bacteria 46276
99 Ga0265342_10000243 3300031712 Bacteria 61174
100 Ga0307415_100211786 3300032126 Bacteria 1547
101 Ga0373926_0176359 3300035083 Bacteria 819
102 Ga0373934_0010577 3300035086 Bacteria 3464
103 Ga0373923_0033923 3300035111 Bacteria 2069
104 Ga0373936_0016250 3300035113 Bacteria 2862
105 Ga0373953_0049748 3300035117 Bacteria 1691
106 Ga0373954_0021877 3300035118 Bacteria 2897
107 Ga0373956_0021880 3300035119 Bacteria 2730
108 Ga0373956_0253499 3300035119 Bacteria 837
109 Ga0373957_0006031 3300035120 Bacteria 3795
110 Ga0373955_0097277 3300035172 Bacteria 1685
111 Ga0373924_0003676 3300035410 Bacteria 5290
112 Ga0373924_0248779 3300035410 Bacteria 787
113 Ga0373931_0036642 3300035691 Bacteria 2558
114 Ga0395899_0001410 3300037312 Bacteria 20607
115 Ga0395900_0006362 3300037418 Bacteria 12311
116 Ga0395898_0011793 3300037466 Bacteria 9060
117 Ga0395905_0013119 3300037471 Bacteria 7954
118 Ga0395901_0010461 3300038443 Bacteria 9397
119 Ga0453683_0208125 3300044673 Unclassified 1242
120 Ga0466963_0569769 3300044694 Bacteria 800
121 Ga0495592_0062693 3300046454 Bacteria 2728
122 Ga0495641_0016637 3300046461 Bacteria 3865
123 Ga0495641_0155226 3300046461 Bacteria 1024
124 Ga0495651_0069173 3300046462 Bacteria 2689
125 Ga0495653_0126788 3300046463 Bacteria 1811
126 Ga0495580_0011706 3300046472 Bacteria 6779
127 Ga0495582_0061492 3300046473 Bacteria 2074
128 Ga0495639_0025427 3300046475 Bacteria 2611
129 Ga0495664_0019501 3300046477 Bacteria 3900
130 Ga0495608_0033369 3300046511 Bacteria 3479
131 Ga0495618_0057565 3300046514 Bacteria 2461
132 Ga0495628_0133528 3300046516 Bacteria 1898
133 Ga0495628_0167048 3300046516 Bacteria 1670
134 Ga0495628_0429986 3300046516 Bacteria 961
135 Ga0495630_0007297 3300046517 Bacteria 7889
136 Ga0495652_0119672 3300046529 Bacteria 2103
137 Ga0495652_0222446 3300046529 Bacteria 1418
138 Ga0495640_0010841 3300046533 Bacteria 7031
139 Ga0495586_0048063 3300046535 Bacteria 2304
140 Ga0495587_0225396 3300046536 Bacteria 1057
141 Ga0495635_0025862 3300046663 Bacteria 4088
142 Ga0495657_0049068 3300046675 Bacteria 2845
143 Ga0495599_0012602 3300046678 Bacteria 5213
144 Ga0495658_0016702 3300046683 Bacteria 3779
145 Ga0495658_0211678 3300046683 Bacteria 1211
146 Ga0495613_0158783 3300046689 Bacteria 1609
147 Ga0495613_0405648 3300046689 Bacteria 929
148 Ga0495600_0006600 3300046809 Bacteria 7068
149 Ga0495604_0265982 3300047317 Bacteria 1164
150 Ga0495674_0013963 3300047319 Bacteria 7533
151 Ga0495680_0100964 3300047322 Bacteria 2149
152 Ga0495675_0022656 3300047444 Bacteria 4005
153 Ga0495684_0063293 3300047471 Bacteria 2812
154 Ga0496101_0249855 3300048904 Bacteria 1382
155 Ga0496104_0003004 3300048907 Bacteria 14521
156 Ga0496106_0294155 3300048909 Bacteria 1302
157 Ga0496110_0538811 3300048913 Bacteria 1061
158 Ga0496115_0030077 3300048918 Bacteria 4270
159 Ga0496115_0153816 3300048918 Bacteria 1900
160 nmdc:mga0qj67_29071_c1 3300050509 Bacteria 4292
161 nmdc:mga0rr50_187887_c1 3300050513 Bacteria 1692
162 nmdc:mga0rr50_36904_c1 3300050513 Bacteria 3523
163 nmdc:mga08x19_120359_c1 3300050514 Bacteria 1760
164 nmdc:mga08x19_4962_c1 3300050514 Bacteria 7862
165 nmdc:mga0a205_18608_c2 3300050515 Bacteria 5093
166 Ga0495595_0143202 3300053084 Bacteria 1173
167 Ga0495619_0016794 3300053085 Bacteria 4634
168 Ga0495619_0029130 3300053085 Bacteria 3566
169 Ga0500556_0200560 3300053104 Bacteria 788
170 Ga0530510_0170273 3300061734 Bacteria 1613
171 Ga0070699_100000014
172 JGI25407J50210_10002678
173 JGI25407J50210_10054923
174 Ga0055536_1006534
175 Ga0055530_10008612
176 Ga0055540_1002961
177 Ga0055531_10005202
178 Ga0065715_10179572
179 Ga0070690_100066605
180 Ga0070690_100072660
181 Ga0070670_100031362
182 Ga0070689_100721657
183 Ga0070703_10003649
184 Ga0070709_10264314
185 Ga0070714_100242764
186 Ga0070714_100309525
187 Ga0070713_100021283
188 Ga0070713_100407968
189 Ga0070705_100001750
190 Ga0070708_100005958
191 Ga0070708_100014959
192 Ga0070708_100054001
193 Ga0070708_100071411
194 Ga0070708_100073117
195 Ga0070708_100089185
196 Ga0070708_100184336
197 Ga0070706_100000342
198 Ga0070706_100000347
199 Ga0070706_100000937
200 Ga0070706_100029546
201 Ga0070707_100001550
202 Ga0070707_100004658
203 Ga0070707_100006879
204 Ga0070707_100018258
205 Ga0070707_100082182
206 Ga0070707_100169410
207 Ga0070707_100184140
208 Ga0070698_100000448
209 Ga0070698_100023332
210 Ga0070698_100035087
211 Ga0070698_100110347
212 Ga0070699_100004649
213 Ga0070697_100000001
214 Ga0070697_100029082
215 Ga0070697_100143641
216 Ga0070697_100283942
217 Ga0070697_100611136
218 Ga0068859_101047261
219 Ga0081455_10005866
220 Ga0081455_10066545
221 Ga0081538_10002039
222 Ga0081538_10002704
223 Ga0070717_10000259
224 Ga0070717_10000677
225 Ga0070717_10007163
226 Ga0070717_10023561
227 Ga0070716_100167644
228 Ga0075430_100012578
229 Ga0075433_10024831
230 Ga0075436_100013625
231 Ga0075436_100319815
232 Ga0097620_101047360
233 Ga0075435_100090621
234 Ga0075435_100681858
235 Ga0111539_10305477
236 Ga0105249_10670624
237 Ga0157375_10441650
238 Ga0197907_10500207
239 Ga0209676_1003614
240 Ga0209050_1003960
241 Ga0209051_1005289
242 Ga0209257_1005780
243 Ga0207684_10000012
244 Ga0207684_10000021
245 Ga0207684_10000988
246 Ga0207684_10065826
247 Ga0207684_10805386
248 Ga0207693_10264794
249 Ga0207646_10000067
250 Ga0207646_10001279
251 Ga0207646_10007595
252 Ga0207646_10070743
253 Ga0207646_10130756
254 Ga0207646_10272250
255 Ga0207646_10274955
256 Ga0207700_10033601
257 Ga0207700_10758840
258 Ga0207664_10035472
259 Ga0207664_10101969
260 Ga0207665_10201155
261 Ga0207665_10223275
262 Ga0207675_100591982
263 Ga0265334_10000022
264 Ga0265323_10066103
265 Ga0265322_10000697
266 Ga0265330_10000292
267 Ga0265329_10001170
268 Ga0265316_10000459
269 Ga0265342_10000243
270 Ga0307415_100211786
271 Ga0373926_0176359
272 Ga0373934_0010577
273 Ga0373923_0033923
274 Ga0373936_0016250
275 Ga0373953_0049748
276 Ga0373954_0021877
277 Ga0373956_0021880
278 Ga0373956_0253499
279 Ga0373957_0006031
280 Ga0373955_0097277
281 Ga0373924_0003676
282 Ga0373924_0248779
283 Ga0373931_0036642
284 Ga0395899_0001410
285 Ga0395900_0006362
286 Ga0395898_0011793
287 Ga0395905_0013119
288 Ga0395901_0010461
289 Ga0453683_0208125
290 Ga0466963_0569769
291 Ga0495592_0062693
292 Ga0495641_0016637
293 Ga0495641_0155226
294 Ga0495651_0069173
295 Ga0495653_0126788
296 Ga0495580_0011706
297 Ga0495582_0061492
298 Ga0495639_0025427
299 Ga0495664_0019501
300 Ga0495608_0033369
301 Ga0495618_0057565
302 Ga0495628_0133528
303 Ga0495628_0167048
304 Ga0495628_0429986
305 Ga0495630_0007297
306 Ga0495652_0119672
307 Ga0495652_0222446
308 Ga0495640_0010841
309 Ga0495586_0048063
310 Ga0495587_0225396
311 Ga0495635_0025862
312 Ga0495657_0049068
313 Ga0495599_0012602
314 Ga0495658_0016702
315 Ga0495658_0211678
316 Ga0495613_0158783
317 Ga0495613_0405648
318 Ga0495600_0006600
319 Ga0495604_0265982
320 Ga0495674_0013963
321 Ga0495680_0100964
322 Ga0495675_0022656
323 Ga0495684_0063293
324 Ga0496101_0249855
325 Ga0496104_0003004
326 Ga0496106_0294155
327 Ga0496110_0538811
328 Ga0496115_0030077
329 Ga0496115_0153816
330 nmdc:mga0qj67_29071_c1
331 nmdc:mga0rr50_187887_c1
332 nmdc:mga0rr50_36904_c1
333 nmdc:mga08x19_120359_c1
334 nmdc:mga08x19_4962_c1
335 nmdc:mga0a205_18608_c2
336 Ga0495595_0143202
337 Ga0495619_0016794
338 Ga0495619_0029130
339 Ga0500556_0200560
340 Ga0530510_0170273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

27

267

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rec-assembly1.cif.gz_E-2 structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii alpha hub bound to 5-hdc 0.8122 188 210
6of8-assembly1.cif.gz_G-2 structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii-alpha hub domain 0.81 188 210
2ux0-assembly1.cif.gz_A structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma 0.7804 188 210
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.7799 43 149
4cag-assembly1.cif.gz_A bacillus licheniformis rhamnogalacturonan lyase pl11 0.7793 188 212
ID Description Score Start End Superfamily
af_Q8RYS9_157_289_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8068 189 210 3.10.450.50
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7748 40 210 3.40.30.10
2w2cN00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7694 188 210 3.10.450.50
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7694 49 216 3.40.30.10
af_Q0D5G1_11_348_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7626 189 213 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A538DDN8-F1-model_v4 DUF899 domain-containing protein 0.9691 1 206
AF-A0A534NQD4-F1-model_v4 DUF899 domain-containing protein 0.9662 1 156
AF-A0A538LY14-F1-model_v4 DUF899 domain-containing protein 0.9644 1 245
AF-A0A7W6R958-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.9632 3 156
AF-A0A538E935-F1-model_v4 DUF899 domain-containing protein 0.9623 1 243

Map