F256367

General Info

Members Datasets Scaffolds Average Seq Length
170 143 340 89

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100242351|Ga0070686_1002423512
Length 98
Sequence MGFLSRNPSVKIAREAEIINKLGLHARPCAKFVKLANSFRSDVWVCKDSDTVNGKSIMGLMMLAAGLGSRLMLTCEGPDAEKALEALEKLILSKFDED

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
42 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
78 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
79 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
97 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
138 2547132512 Azospira oryzae 6a3 Isolate Unclassified
139 2721755523 Delftia sp. HK171 Isolate Unclassified
140 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
141 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
142 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
143 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.35
Nodule 2.35
Rhizoplane 3.53
Rhizosphere 60.59
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100242351 3300005544 Unclassified 1313
2 JGI25156J39149_1000040 3300002705 Bacteria 106617
3 JGI25154J39366_1000060 3300002738 Bacteria 106617
4 JGI25157J39369_1000058 3300002741 Bacteria 106617
5 JGI25150J39212_1030202 3300002774 Bacteria 755
6 JGI25159J45721_1000140 3300002987 Bacteria 33403
7 JGI25160J50197_1000198 3300003354 Bacteria 50243
8 JGI25161J50226_1000021 3300003374 Bacteria 163584
9 Ga0055537_1008598 3300003773 Bacteria 2338
10 Ga0055536_1079976 3300003781 Bacteria 622
11 Ga0055534_1001448 3300003784 Bacteria 9436
12 Ga0055534_1026194 3300003784 Bacteria 930
13 Ga0055530_10046641 3300003791 Bacteria 1028
14 Ga0055543_1000238 3300004625 Bacteria 42822
15 Ga0065704_10081947 3300005289 Bacteria 3677
16 Ga0070680_101002784 3300005336 Bacteria 721
17 Ga0070692_10327559 3300005345 Bacteria 944
18 Ga0070705_101728868 3300005440 Bacteria 529
19 Ga0070700_100002610 3300005441 Bacteria 9209
20 Ga0068867_100185820 3300005459 Bacteria 1655
21 Ga0070685_11231617 3300005466 Bacteria 570
22 Ga0068853_100000060 3300005539 Bacteria 78205
23 Ga0070672_100264511 3300005543 Bacteria 1451
24 Ga0070672_100838953 3300005543 Bacteria 810
25 Ga0070696_100291331 3300005546 Bacteria 1247
26 Ga0070665_100009996 3300005548 Bacteria 9599
27 Ga0070665_101018900 3300005548 Bacteria 840
28 Ga0068866_10596695 3300005718 Bacteria 745
29 Ga0075365_10122916 3300006038 Bacteria 1792
30 Ga0075363_100574591 3300006048 Bacteria 674
31 Ga0075364_10066192 3300006051 Bacteria 2373
32 Ga0075362_10003850 3300006177 Bacteria 5327
33 Ga0075362_10633952 3300006177 Bacteria 554
34 Ga0075369_10093300 3300006186 Bacteria 1345
35 Ga0075366_10315924 3300006195 Bacteria 956
36 Ga0079104_1000623 3300006946 Bacteria 34666
37 Ga0079104_1006144 3300006946 Bacteria 4624
38 Ga0105250_10000388 3300009092 Bacteria 32790
39 Ga0105243_10035579 3300009148 Bacteria 3861
40 Ga0105243_10037414 3300009148 Bacteria 3772
41 Ga0105243_12459990 3300009148 Bacteria 559
42 Ga0105237_12289228 3300009545 Bacteria 550
43 Ga0157323_1010707 3300012495 Bacteria 726
44 Ga0157374_12409819 3300013296 Bacteria 554
45 Ga0163163_11138840 3300014325 Bacteria 843
46 Ga0182008_10001996 3300014497 Bacteria 13096
47 Ga0157379_10626141 3300014968 Bacteria 1006
48 Ga0209435_100019 3300025206 Bacteria 260989
49 Ga0209436_105017 3300025208 Bacteria 3144
50 Ga0207425_1004884 3300025245 Bacteria 3927
51 Ga0209646_1000038 3300025246 Bacteria 353982
52 Ga0209026_1000048 3300025250 Bacteria 257264
53 Ga0209759_1000038 3300025256 Bacteria 257264
54 Ga0209565_1000511 3300025263 Bacteria 28072
55 Ga0209673_1056238 3300025273 Bacteria 1008
56 Ga0209130_1000103 3300025284 Bacteria 137115
57 Ga0209130_1002013 3300025284 Bacteria 11077
58 Ga0209675_1001066 3300025291 Bacteria 16979
59 Ga0209675_1001435 3300025291 Bacteria 13767
60 Ga0209564_1071015 3300025295 Bacteria 723
61 Ga0209758_1068087 3300025297 Bacteria 1135
62 Ga0209050_1004538 3300025298 Bacteria 9334
63 Ga0207426_1000586 3300025302 Bacteria 48467
64 Ga0209051_1020246 3300025303 Bacteria 2872
65 Ga0209257_1009548 3300025304 Bacteria 5158
66 Ga0207696_1002807 3300025711 Bacteria 8267
67 Ga0207688_10193985 3300025901 Bacteria 1216
68 Ga0207709_10000696 3300025935 Bacteria 27115
69 Ga0207709_10064349 3300025935 Bacteria 2302
70 Ga0207691_10242240 3300025940 Bacteria 1559
71 Ga0207691_10338050 3300025940 Bacteria 1289
72 Ga0207651_10045274 3300025960 Bacteria 2950
73 Ga0207639_10000087 3300026041 Bacteria 79236
74 Ga0207678_10965836 3300026067 Bacteria 754
75 Ga0207708_10011753 3300026075 Bacteria 6523
76 Ga0207648_10377445 3300026089 Bacteria 1282
77 Ga0207683_10085464 3300026121 Bacteria 2805
78 Ga0209281_1000072 3300027111 Bacteria 273114
79 Ga0209281_1010496 3300027111 Bacteria 2117
80 Ga0268266_10169403 3300028379 Bacteria 1981
81 Ga0265323_10003286 3300028653 Bacteria 7194
82 Ga0265327_10299769 3300031251 Bacteria 708
83 Ga0265316_10080418 3300031344 Bacteria 2499
84 Ga0265316_10162562 3300031344 Bacteria 1669
85 Ga0265316_10741554 3300031344 Bacteria 691
86 Ga0307408_100084217 3300031548 Bacteria 2384
87 Ga0307516_10017707 3300031730 Bacteria 7423
88 Ga0307516_10121229 3300031730 Bacteria 2405
89 Ga0307405_10783824 3300031731 Bacteria 797
90 Ga0307406_10337488 3300031901 Bacteria 1172
91 Ga0307414_10641166 3300032004 Bacteria 957
92 Ga0373948_0149740 3300034817 Bacteria 582
93 Ga0373928_0068578 3300035084 Bacteria 872
94 Ga0373951_0189907 3300035091 Bacteria 594
95 Ga0373939_0303820 3300035114 Bacteria 637
96 Ga0373931_0999191 3300035691 Bacteria 566
97 Ga0395899_0014965 3300037312 Bacteria 5917
98 Ga0395900_0024903 3300037418 Bacteria 6123
99 Ga0395898_0003864 3300037466 Bacteria 16558
100 Ga0395905_0001870 3300037471 Bacteria 24233
101 Ga0395905_0050491 3300037471 Bacteria 3897
102 Ga0395905_0151595 3300037471 Unclassified 2181
103 Ga0395901_0029137 3300038443 Bacteria 5681
104 Ga0436361_1178762 3300039447 Bacteria 933
105 Ga0451787_099704 3300041441 Bacteria 782
106 Ga0451791_1479488 3300041451 Bacteria 802
107 Ga0451797_0804599 3300041453 Bacteria 587
108 Ga0451795_0706515 3300041456 Bacteria 585
109 Ga0451807_1739638 3300041486 Bacteria 858
110 Ga0451851_0473816 3300041507 Bacteria 819
111 Ga0451843_0473036 3300041509 Bacteria 1746
112 Ga0439455_0131385 3300042012 Bacteria 706
113 Ga0439444_0126776 3300042437 Bacteria 600
114 Ga0439459_0038900 3300042438 Bacteria 1002
115 Ga0439464_0003049 3300042439 Bacteria 4190
116 Ga0451577_0007764 3300042876 Bacteria 10516
117 Ga0451577_0033517 3300042876 Bacteria 4630
118 Ga0451577_0477064 3300042876 Bacteria 1132
119 Ga0451577_0834454 3300042876 Bacteria 832
120 Ga0451577_1099956 3300042876 Bacteria 711
121 Ga0453684_0028145 3300044712 Bacteria 8033
122 Ga0453684_0223094 3300044712 Bacteria 2182
123 Ga0453684_0741881 3300044712 Bacteria 1064
124 Ga0453684_0922067 3300044712 Bacteria 934
125 Ga0453684_2201851 3300044712 Bacteria 550
126 Ga0466967_0205480 3300045976 Bacteria 1867
127 Ga0495639_0650810 3300046475 Bacteria 543
128 Ga0495631_0250920 3300046518 Bacteria 754
129 Ga0495643_0038737 3300046522 Bacteria 2609
130 Ga0495663_0061144 3300046525 Bacteria 1184
131 Ga0495642_0007600 3300046528 Bacteria 4153
132 Ga0495621_0052279 3300046539 Bacteria 1464
133 Ga0495597_0001717 3300046542 Bacteria 15163
134 Ga0495633_0098308 3300046558 Bacteria 1359
135 Ga0495656_0022090 3300046615 Bacteria 2487
136 Ga0495588_0208118 3300046674 Bacteria 1033
137 Ga0495588_0312610 3300046674 Bacteria 827
138 Ga0495669_0012524 3300046684 Bacteria 3611
139 Ga0495670_0102320 3300046691 Bacteria 1476
140 Ga0495636_0094017 3300047318 Bacteria 1304
141 Ga0495677_0015570 3300047445 Bacteria 2763
142 Ga0495685_225396 3300047447 Bacteria 597
143 Ga0495681_0120087 3300047470 Bacteria 1129
144 Ga0495615_0127551 3300048090 Bacteria 741
145 Ga0496111_0777186 3300048914 Bacteria 694
146 Ga0496122_0016221 3300048925 Bacteria 7070
147 Ga0496123_0080931 3300048926 Bacteria 1976
148 Ga0496125_0001050 3300048928 Bacteria 42713
149 Ga0496126_0028407 3300048929 Bacteria 5331
150 Ga0496126_0452855 3300048929 Bacteria 1033
151 Ga0501290_045474 3300049513 Bacteria 670
152 Ga0501036_0580025 3300049572 Bacteria 931
153 Ga0501046_0644179 3300049580 Bacteria 749
154 Ga0501047_0129190 3300049581 Bacteria 2407
155 Ga0501070_1227272 3300049586 Bacteria 575
156 Ga0501228_038219 3300049666 Bacteria 615
157 nmdc:mga03n38_556096_c1 3300050490 Bacteria 649
158 nmdc:mga00v17_21149_c1 3300050491 Bacteria 3737
159 nmdc:mga0yw44_138456_c1 3300050492 Bacteria 1580
160 nmdc:mga0k408_574145_c1 3300050493 Bacteria 666
161 nmdc:mga07m45_578393_c1 3300050496 Bacteria 649
162 Ga0500618_040190 3300053125 Bacteria 1075
163 Ga0500622_0100965 3300053156 Bacteria 1421
164 2511244983 2511231002 Bacteria 5042903
165 2548847254 2547132512 Bacteria 3416496
166 2722881238 2721755523 Bacteria 6430384
167 2839142966 2839138175 Bacteria 6549354
168 2904435126 2904434214 Bacteria 6230908
169 2939634272 2939631187 Bacteria 6118131
170 8048750056 8048746797 Bacteria 3557226
171 Ga0070686_100242351
172 JGI25156J39149_1000040
173 JGI25154J39366_1000060
174 JGI25157J39369_1000058
175 JGI25150J39212_1030202
176 JGI25159J45721_1000140
177 JGI25160J50197_1000198
178 JGI25161J50226_1000021
179 Ga0055537_1008598
180 Ga0055536_1079976
181 Ga0055534_1001448
182 Ga0055534_1026194
183 Ga0055530_10046641
184 Ga0055543_1000238
185 Ga0065704_10081947
186 Ga0070680_101002784
187 Ga0070692_10327559
188 Ga0070705_101728868
189 Ga0070700_100002610
190 Ga0068867_100185820
191 Ga0070685_11231617
192 Ga0068853_100000060
193 Ga0070672_100264511
194 Ga0070672_100838953
195 Ga0070696_100291331
196 Ga0070665_100009996
197 Ga0070665_101018900
198 Ga0068866_10596695
199 Ga0075365_10122916
200 Ga0075363_100574591
201 Ga0075364_10066192
202 Ga0075362_10003850
203 Ga0075362_10633952
204 Ga0075369_10093300
205 Ga0075366_10315924
206 Ga0079104_1000623
207 Ga0079104_1006144
208 Ga0105250_10000388
209 Ga0105243_10035579
210 Ga0105243_10037414
211 Ga0105243_12459990
212 Ga0105237_12289228
213 Ga0157323_1010707
214 Ga0157374_12409819
215 Ga0163163_11138840
216 Ga0182008_10001996
217 Ga0157379_10626141
218 Ga0209435_100019
219 Ga0209436_105017
220 Ga0207425_1004884
221 Ga0209646_1000038
222 Ga0209026_1000048
223 Ga0209759_1000038
224 Ga0209565_1000511
225 Ga0209673_1056238
226 Ga0209130_1000103
227 Ga0209130_1002013
228 Ga0209675_1001066
229 Ga0209675_1001435
230 Ga0209564_1071015
231 Ga0209758_1068087
232 Ga0209050_1004538
233 Ga0207426_1000586
234 Ga0209051_1020246
235 Ga0209257_1009548
236 Ga0207696_1002807
237 Ga0207688_10193985
238 Ga0207709_10000696
239 Ga0207709_10064349
240 Ga0207691_10242240
241 Ga0207691_10338050
242 Ga0207651_10045274
243 Ga0207639_10000087
244 Ga0207678_10965836
245 Ga0207708_10011753
246 Ga0207648_10377445
247 Ga0207683_10085464
248 Ga0209281_1000072
249 Ga0209281_1010496
250 Ga0268266_10169403
251 Ga0265323_10003286
252 Ga0265327_10299769
253 Ga0265316_10080418
254 Ga0265316_10162562
255 Ga0265316_10741554
256 Ga0307408_100084217
257 Ga0307516_10017707
258 Ga0307516_10121229
259 Ga0307405_10783824
260 Ga0307406_10337488
261 Ga0307414_10641166
262 Ga0373948_0149740
263 Ga0373928_0068578
264 Ga0373951_0189907
265 Ga0373939_0303820
266 Ga0373931_0999191
267 Ga0395899_0014965
268 Ga0395900_0024903
269 Ga0395898_0003864
270 Ga0395905_0001870
271 Ga0395905_0050491
272 Ga0395905_0151595
273 Ga0395901_0029137
274 Ga0436361_1178762
275 Ga0451787_099704
276 Ga0451791_1479488
277 Ga0451797_0804599
278 Ga0451795_0706515
279 Ga0451807_1739638
280 Ga0451851_0473816
281 Ga0451843_0473036
282 Ga0439455_0131385
283 Ga0439444_0126776
284 Ga0439459_0038900
285 Ga0439464_0003049
286 Ga0451577_0007764
287 Ga0451577_0033517
288 Ga0451577_0477064
289 Ga0451577_0834454
290 Ga0451577_1099956
291 Ga0453684_0028145
292 Ga0453684_0223094
293 Ga0453684_0741881
294 Ga0453684_0922067
295 Ga0453684_2201851
296 Ga0466967_0205480
297 Ga0495639_0650810
298 Ga0495631_0250920
299 Ga0495643_0038737
300 Ga0495663_0061144
301 Ga0495642_0007600
302 Ga0495621_0052279
303 Ga0495597_0001717
304 Ga0495633_0098308
305 Ga0495656_0022090
306 Ga0495588_0208118
307 Ga0495588_0312610
308 Ga0495669_0012524
309 Ga0495670_0102320
310 Ga0495636_0094017
311 Ga0495677_0015570
312 Ga0495685_225396
313 Ga0495681_0120087
314 Ga0495615_0127551
315 Ga0496111_0777186
316 Ga0496122_0016221
317 Ga0496123_0080931
318 Ga0496125_0001050
319 Ga0496126_0028407
320 Ga0496126_0452855
321 Ga0501290_045474
322 Ga0501036_0580025
323 Ga0501046_0644179
324 Ga0501047_0129190
325 Ga0501070_1227272
326 Ga0501228_038219
327 nmdc:mga03n38_556096_c1
328 nmdc:mga00v17_21149_c1
329 nmdc:mga0yw44_138456_c1
330 nmdc:mga0k408_574145_c1
331 nmdc:mga07m45_578393_c1
332 Ga0500618_040190
333 Ga0500622_0100965
334 2511244983
335 2548847254
336 2722881238
337 2839142966
338 2904435126
339 2939634272
340 8048750056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

12

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.98 1 77
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9717 1 83
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9706 2 79
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9701 1 83
2hpr-assembly1.cif.gz_A histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c) 0.9679 2 82
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9704 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9693 2 79 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9615 2 86 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9597 4 82 3.30.1340.10
1pchA00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9513 2 83 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A521Y6V3-F1-model_v4 HPr family phosphocarrier protein 1.001 1 86 GO:0005737
GO:0009401
AF-A0A7W7Y624-F1-model_v4 Phosphotransferase system HPr (HPr) family protein 1 2 86 GO:0005737
GO:0009401
GO:0016740
AF-A0A239A1A9-F1-model_v4 Phosphocarrier protein 0.9998 2 86 GO:0005737
GO:0009401
AF-A0A353QKE9-F1-model_v4 deleted 0.9996 2 86
AF-A0A212PHL2-F1-model_v4 Phosphocarrier protein 0.9991 2 86 GO:0005737
GO:0009401

Map