F256589

General Info

Members Datasets Scaffolds Average Seq Length
170 109 340 187

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100222584|Ga0075434_1002225842
Length 215
Sequence MAQPTQAAKSKSKDGKGGKPKATAPSGPGRPTPEGYVPRLKVRYKEEVVPKLKKEFGIDNVMAVPRVERISLNMGMGEAIQNVKILDDAVEEMAALAGQKPTITRAQKSIAAFKLREGMPIGCRVTLRGDRMWEFLDRLIAVALPRVRDFRGVPSKSFDGRGNYTLGIRDHLIFPEVDYNKVEKPKGMNITIVTTAGNDERALYLLRELGMPFTR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
83 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
84 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
85 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
86 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
87 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
88 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
89 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.35
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100222584 3300006871 Bacteria 1907
2 Ga0065704_10136669 3300005289 Bacteria 1563
3 Ga0065707_10006204 3300005295 Bacteria 4061
4 Ga0070658_10019308 3300005327 Bacteria 5458
5 Ga0070658_10205516 3300005327 Bacteria 1663
6 Ga0070690_100087925 3300005330 Bacteria 2042
7 Ga0070670_100029495 3300005331 Bacteria 4723
8 Ga0070666_10004036 3300005335 Bacteria 8909
9 Ga0070666_10011673 3300005335 Bacteria 5522
10 Ga0070682_100158277 3300005337 Bacteria 1562
11 Ga0068868_100020247 3300005338 Bacteria 4995
12 Ga0070669_100000040 3300005353 Bacteria 130277
13 Ga0070671_100153226 3300005355 Bacteria 1946
14 Ga0070673_100226177 3300005364 Bacteria 1621
15 Ga0070667_100264678 3300005367 Bacteria 1540
16 Ga0070709_10000076 3300005434 Bacteria 74077
17 Ga0070678_100006394 3300005456 Bacteria 6913
18 Ga0070662_100146168 3300005457 Bacteria 1837
19 Ga0070685_10027243 3300005466 Bacteria 3157
20 Ga0070698_100226921 3300005471 Bacteria 1801
21 Ga0070679_100361655 3300005530 Bacteria 1398
22 Ga0070672_100222200 3300005543 Bacteria 1584
23 Ga0070665_100001128 3300005548 Bacteria 32835
24 Ga0070665_100720655 3300005548 Bacteria 1010
25 Ga0068859_100163938 3300005617 Bacteria 2302
26 Ga0068861_100959476 3300005719 Bacteria 814
27 Ga0068863_100061234 3300005841 Bacteria 3558
28 Ga0068858_100183416 3300005842 Bacteria 1976
29 Ga0097621_100054524 3300006237 Bacteria 3261
30 Ga0068871_100129959 3300006358 Bacteria 2135
31 Ga0075433_10042499 3300006852 Bacteria 3944
32 Ga0075434_100027300 3300006871 Bacteria 5604
33 Ga0068865_100762612 3300006881 Bacteria 832
34 Ga0075436_100000105 3300006914 Bacteria 50007
35 Ga0075436_100003766 3300006914 Bacteria 10400
36 Ga0097620_100163956 3300006931 Bacteria 2302
37 Ga0111539_10030320 3300009094 Bacteria 6575
38 Ga0157374_10002664 3300013296 Bacteria 15039
39 Ga0157378_10096295 3300013297 Bacteria 2697
40 Ga0163163_10036365 3300014325 Bacteria 4782
41 Ga0157377_10046193 3300014745 Bacteria 2434
42 Ga0207692_10084512 3300025898 Bacteria 1705
43 Ga0207680_10012875 3300025903 Bacteria 4275
44 Ga0207680_10033943 3300025903 Bacteria 2915
45 Ga0207699_10000182 3300025906 Bacteria 38240
46 Ga0207699_10426701 3300025906 Bacteria 948
47 Ga0207645_10117956 3300025907 Bacteria 1722
48 Ga0207645_10662211 3300025907 Bacteria 709
49 Ga0207654_10330278 3300025911 Bacteria 1045
50 Ga0207681_10000015 3300025923 Bacteria 352892
51 Ga0207681_10538405 3300025923 Bacteria 960
52 Ga0207650_10116501 3300025925 Bacteria 2075
53 Ga0207659_10389552 3300025926 Bacteria 1163
54 Ga0207644_10096642 3300025931 Bacteria 2211
55 Ga0207704_10132076 3300025938 Bacteria 1731
56 Ga0207704_10589172 3300025938 Bacteria 909
57 Ga0207658_10147666 3300025986 Bacteria 1911
58 Ga0207658_10221476 3300025986 Bacteria 1592
59 Ga0207703_10310817 3300026035 Bacteria 1440
60 Ga0207678_10201508 3300026067 Bacteria 1702
61 Ga0207641_10037244 3300026088 Bacteria 4061
62 Ga0207676_10013005 3300026095 Bacteria 5975
63 Ga0207683_10005107 3300026121 Bacteria 11263
64 Ga0207683_11440117 3300026121 Bacteria 637
65 Ga0209998_10015160 3300027717 Bacteria 1612
66 Ga0209974_10001593 3300027876 Bacteria 8213
67 Ga0268266_10000745 3300028379 Bacteria 43623
68 Ga0268266_10052597 3300028379 Bacteria 3497
69 Ga0268264_10006187 3300028381 Bacteria 10112
70 Ga0265328_10085890 3300031239 Bacteria 1161
71 Ga0265329_10102765 3300031242 Bacteria 910
72 Ga0265316_10026754 3300031344 Bacteria 4792
73 Ga0265316_10504291 3300031344 Bacteria 864
74 Ga0307508_10005222 3300031616 Bacteria 12422
75 Ga0316575_10179720 3300031665 Bacteria 878
76 Ga0316579_10193274 3300031691 Unclassified 984
77 Ga0316576_10003670 3300031727 Bacteria 9058
78 Ga0316576_10251833 3300031727 Bacteria 1326
79 Ga0316576_10330619 3300031727 Bacteria 1136
80 Ga0316578_10007640 3300031728 Bacteria 5440
81 Ga0316577_10173925 3300031733 Bacteria 1215
82 Ga0316577_10281621 3300031733 Bacteria 941
83 Ga0316583_10003219 3300032133 Bacteria 5745
84 Ga0316583_10007001 3300032133 Bacteria 4056
85 Ga0316585_10074319 3300032137 Unclassified 1105
86 Ga0316580_10051241 3300032139 Bacteria 1272
87 Ga0316593_10000059 3300032168 Bacteria 12661
88 Ga0316592_1001202 3300033524 Bacteria 4083
89 Ga0316588_1054633 3300033528 Unclassified 971
90 Ga0373929_0000002 3300035085 Bacteria 683932
91 Ga0373929_0006221 3300035085 Bacteria 2156
92 Ga0373939_0095454 3300035114 Bacteria 1012
93 Ga0373956_0262790 3300035119 Unclassified 821
94 Ga0373961_0000555 3300035241 Bacteria 14114
95 Ga0316574_0000856 3300035398 Bacteria 13374
96 Ga0316574_0104244 3300035398 Bacteria 1816
97 Ga0316574_0176324 3300035398 Bacteria 1376
98 Ga0373931_0207280 3300035691 Bacteria 1174
99 Ga0373935_0001807 3300035692 Bacteria 12023
100 Ga0373947_0064035 3300035725 Bacteria 2241
101 Ga0316582_0001586 3300036647 Bacteria 10123
102 Ga0316582_0037065 3300036647 Bacteria 3020
103 Ga0316582_0068474 3300036647 Bacteria 2292
104 Ga0316582_0079613 3300036647 Bacteria 2137
105 Ga0316582_0108321 3300036647 Bacteria 1847
106 Ga0316582_0785220 3300036647 Bacteria 653
107 Ga0316584_0007094 3300036712 Bacteria 7633
108 Ga0316584_0032070 3300036712 Bacteria 3887
109 Ga0316584_0414345 3300036712 Bacteria 958
110 Ga0316581_0132131 3300037588 Unclassified 770
111 Ga0400484_34156 3300038725 Bacteria 2291
112 Ga0400484_37672 3300038725 Bacteria 9379
113 Ga0400490_25033 3300038726 Bacteria 1735
114 Ga0400490_44797 3300038726 Bacteria 1467
115 Ga0400485_00520 3300038735 Bacteria 3394
116 Ga0400485_06724 3300038735 Bacteria 9642
117 Ga0400485_15015 3300038735 Bacteria 1077
118 Ga0400488_47093 3300038741 Bacteria 5214
119 Ga0400486_09544 3300038742 Bacteria 18982
120 Ga0400486_32047 3300038742 Bacteria 23991
121 Ga0400486_33075 3300038742 Bacteria 8482
122 Ga0400483_186712 3300039062 Bacteria 4615
123 Ga0400483_196777 3300039062 Bacteria 4135
124 Ga0400483_228134 3300039062 Bacteria 119181
125 Ga0400489_41472 3300039093 Bacteria 14759
126 Ga0400489_54996 3300039093 Bacteria 1180
127 Ga0400487_49771 3300039110 Bacteria 3399
128 Ga0451797_0471035 3300041453 Bacteria 1066
129 Ga0451807_0702038 3300041486 Bacteria 762
130 Ga0451807_2327719 3300041486 Bacteria 1136
131 Ga0451843_1629635 3300041509 Bacteria 1066
132 Ga0451853_3571108 3300041512 Bacteria 1008
133 Ga0451577_0023525 3300042876 Bacteria 5617
134 Ga0451577_0033000 3300042876 Bacteria 4666
135 Ga0451577_0136455 3300042876 Bacteria 2203
136 Ga0453683_0000633 3300044673 Bacteria 38199
137 Ga0453683_0000848 3300044673 Bacteria 29516
138 Ga0453683_0005086 3300044673 Bacteria 9225
139 Ga0453683_0084059 3300044673 Bacteria 1994
140 Ga0466963_0054711 3300044694 Bacteria 2653
141 Ga0453684_0003118 3300044712 Bacteria 38183
142 Ga0453684_0008501 3300044712 Bacteria 18357
143 Ga0453684_0021782 3300044712 Bacteria 9550
144 Ga0453684_0023560 3300044712 Bacteria 9054
145 Ga0453684_0048795 3300044712 Bacteria 5591
146 Ga0453684_0048799 3300044712 Bacteria 5591
147 Ga0453684_0054489 3300044712 Bacteria 5209
148 Ga0453684_0062959 3300044712 Bacteria 4748
149 Ga0453684_0070322 3300044712 Bacteria 4432
150 Ga0453684_0101985 3300044712 Bacteria 3510
151 Ga0453684_0279166 3300044712 Bacteria 1906
152 Ga0453684_0673120 3300044712 Bacteria 1127
153 Ga0453684_1277868 3300044712 Bacteria 767
154 Ga0451576_0000554 3300045051 Bacteria 80199
155 Ga0451576_0000857 3300045051 Bacteria 58872
156 Ga0451576_0380166 3300045051 Bacteria 1480
157 Ga0451576_0497764 3300045051 Bacteria 1280
158 Ga0451576_1294035 3300045051 Bacteria 760
159 Ga0495615_0022631 3300048090 Bacteria 1431
160 Ga0496114_0000001 3300048917 Bacteria 893286
161 Ga0501075_0326274 3300049591 Bacteria 1170
162 Ga0501081_0391333 3300049743 Bacteria 1028
163 Ga0501083_0002042 3300049744 Bacteria 13908
164 nmdc:mga0n895_108312_c1 3300050512 Bacteria 2793
165 nmdc:mga0n895_152575_c1 3300050512 Bacteria 2341
166 nmdc:mga0n895_21250_c1 3300050512 Bacteria 6065
167 nmdc:mga0rr50_345676_c1 3300050513 Bacteria 1250
168 nmdc:mga08x19_1503_c1 3300050514 Bacteria 14447
169 nmdc:mga0a205_170118_c1 3300050515 Bacteria 2075
170 Ga0501082_0762966 3300060353 Bacteria 846
171 Ga0075434_100222584
172 Ga0065704_10136669
173 Ga0065707_10006204
174 Ga0070658_10019308
175 Ga0070658_10205516
176 Ga0070690_100087925
177 Ga0070670_100029495
178 Ga0070666_10004036
179 Ga0070666_10011673
180 Ga0070682_100158277
181 Ga0068868_100020247
182 Ga0070669_100000040
183 Ga0070671_100153226
184 Ga0070673_100226177
185 Ga0070667_100264678
186 Ga0070709_10000076
187 Ga0070678_100006394
188 Ga0070662_100146168
189 Ga0070685_10027243
190 Ga0070698_100226921
191 Ga0070679_100361655
192 Ga0070672_100222200
193 Ga0070665_100001128
194 Ga0070665_100720655
195 Ga0068859_100163938
196 Ga0068861_100959476
197 Ga0068863_100061234
198 Ga0068858_100183416
199 Ga0097621_100054524
200 Ga0068871_100129959
201 Ga0075433_10042499
202 Ga0075434_100027300
203 Ga0068865_100762612
204 Ga0075436_100000105
205 Ga0075436_100003766
206 Ga0097620_100163956
207 Ga0111539_10030320
208 Ga0157374_10002664
209 Ga0157378_10096295
210 Ga0163163_10036365
211 Ga0157377_10046193
212 Ga0207692_10084512
213 Ga0207680_10012875
214 Ga0207680_10033943
215 Ga0207699_10000182
216 Ga0207699_10426701
217 Ga0207645_10117956
218 Ga0207645_10662211
219 Ga0207654_10330278
220 Ga0207681_10000015
221 Ga0207681_10538405
222 Ga0207650_10116501
223 Ga0207659_10389552
224 Ga0207644_10096642
225 Ga0207704_10132076
226 Ga0207704_10589172
227 Ga0207658_10147666
228 Ga0207658_10221476
229 Ga0207703_10310817
230 Ga0207678_10201508
231 Ga0207641_10037244
232 Ga0207676_10013005
233 Ga0207683_10005107
234 Ga0207683_11440117
235 Ga0209998_10015160
236 Ga0209974_10001593
237 Ga0268266_10000745
238 Ga0268266_10052597
239 Ga0268264_10006187
240 Ga0265328_10085890
241 Ga0265329_10102765
242 Ga0265316_10026754
243 Ga0265316_10504291
244 Ga0307508_10005222
245 Ga0316575_10179720
246 Ga0316579_10193274
247 Ga0316576_10003670
248 Ga0316576_10251833
249 Ga0316576_10330619
250 Ga0316578_10007640
251 Ga0316577_10173925
252 Ga0316577_10281621
253 Ga0316583_10003219
254 Ga0316583_10007001
255 Ga0316585_10074319
256 Ga0316580_10051241
257 Ga0316593_10000059
258 Ga0316592_1001202
259 Ga0316588_1054633
260 Ga0373929_0000002
261 Ga0373929_0006221
262 Ga0373939_0095454
263 Ga0373956_0262790
264 Ga0373961_0000555
265 Ga0316574_0000856
266 Ga0316574_0104244
267 Ga0316574_0176324
268 Ga0373931_0207280
269 Ga0373935_0001807
270 Ga0373947_0064035
271 Ga0316582_0001586
272 Ga0316582_0037065
273 Ga0316582_0068474
274 Ga0316582_0079613
275 Ga0316582_0108321
276 Ga0316582_0785220
277 Ga0316584_0007094
278 Ga0316584_0032070
279 Ga0316584_0414345
280 Ga0316581_0132131
281 Ga0400484_34156
282 Ga0400484_37672
283 Ga0400490_25033
284 Ga0400490_44797
285 Ga0400485_00520
286 Ga0400485_06724
287 Ga0400485_15015
288 Ga0400488_47093
289 Ga0400486_09544
290 Ga0400486_32047
291 Ga0400486_33075
292 Ga0400483_186712
293 Ga0400483_196777
294 Ga0400483_228134
295 Ga0400489_41472
296 Ga0400489_54996
297 Ga0400487_49771
298 Ga0451797_0471035
299 Ga0451807_0702038
300 Ga0451807_2327719
301 Ga0451843_1629635
302 Ga0451853_3571108
303 Ga0451577_0023525
304 Ga0451577_0033000
305 Ga0451577_0136455
306 Ga0453683_0000633
307 Ga0453683_0000848
308 Ga0453683_0005086
309 Ga0453683_0084059
310 Ga0466963_0054711
311 Ga0453684_0003118
312 Ga0453684_0008501
313 Ga0453684_0021782
314 Ga0453684_0023560
315 Ga0453684_0048795
316 Ga0453684_0048799
317 Ga0453684_0054489
318 Ga0453684_0062959
319 Ga0453684_0070322
320 Ga0453684_0101985
321 Ga0453684_0279166
322 Ga0453684_0673120
323 Ga0453684_1277868
324 Ga0451576_0000554
325 Ga0451576_0000857
326 Ga0451576_0380166
327 Ga0451576_0497764
328 Ga0451576_1294035
329 Ga0495615_0022631
330 Ga0496114_0000001
331 Ga0501075_0326274
332 Ga0501081_0391333
333 Ga0501083_0002042
334 nmdc:mga0n895_108312_c1
335 nmdc:mga0n895_152575_c1
336 nmdc:mga0n895_21250_c1
337 nmdc:mga0rr50_345676_c1
338 nmdc:mga08x19_1503_c1
339 nmdc:mga0a205_170118_c1
340 Ga0501082_0762966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

60

116

1

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

120

213

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9886 3 177
6ore-assembly1.cif.gz_E release complex 70s 0.9738 3 178
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9725 3 177
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.971 4 179
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9705 3 176
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9667 3 178 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9561 3 178 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9361 22 179 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9296 22 177 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9143 22 177 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A2H5YPI2-F1-model_v4 Large ribosomal subunit protein uL5 0.9861 3 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3A4NVN9-F1-model_v4 Large ribosomal subunit protein uL5 0.9858 3 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N2A3C4-F1-model_v4 Large ribosomal subunit protein uL5 0.9856 1 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-E4QSC5-F1-model_v4 Large ribosomal subunit protein uL5 0.9844 28 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F5YHU8-F1-model_v4 Large ribosomal subunit protein uL5 0.9839 1 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map