F256902

General Info

Members Datasets Scaffolds Average Seq Length
170 91 170 228

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10001668|Ga0207663_100016683
Length 252
Sequence MEDREWKLIRLQMPSSIFYPPSSLFMNDPAPANPELLRSLGRLARGLSALFWGLPASLVVCAETARADWLKPWFFMPALVATALPLYGLWLMGDFQKQERPWRNALDRALLLGLVNFGLCPFLYWHNQMPAQPFFNAAIFVLTLSIILFLFNLNVVIKQLGAMLPDETLRHETRQFTALNRGLLAALLFFGVAYVVLLQDPRLPVALGALFGWLQDFGFWGLTVFALLPLAMTMALIWKTKETILDSVFSAK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
11 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
12 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
13 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
14 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
23 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
24 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
25 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
26 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
27 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
34 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
38 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
39 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
40 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
41 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
42 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
43 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
44 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
45 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
46 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
47 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
48 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
49 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
50 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
51 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
52 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
53 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0
Rhizosphere 98.24
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10082941 3300003320 Bacteria 11158
2 rootH1_10195635 3300003323 Unclassified 1214
3 Ga0070689_100119218 3300005340 Bacteria 2106
4 Ga0070689_100520666 3300005340 Bacteria 1021
5 Ga0070711_100000512 3300005439 Bacteria 20157
6 Ga0070685_10099326 3300005466 Bacteria 1775
7 Ga0068856_100104912 3300005614 Unclassified 2821
8 Ga0068856_100345948 3300005614 Unclassified 1505
9 Ga0068859_100603830 3300005617 Bacteria 1190
10 Ga0068863_100038452 3300005841 Bacteria 4552
11 Ga0097620_100603886 3300006931 Bacteria 1190
12 Ga0105242_10023592 3300009176 Bacteria 4848
13 Ga0105237_11010064 3300009545 Bacteria 839
14 Ga0157374_10511188 3300013296 Unclassified 1206
15 Ga0157376_11081421 3300014969 Bacteria 827
16 Ga0207695_10183419 3300025913 Unclassified 2013
17 Ga0207663_10001668 3300025916 Bacteria 10452
18 Ga0207694_10014836 3300025924 Bacteria 5875
19 Ga0207711_10140173 3300025941 Bacteria 2175
20 Ga0207667_10012282 3300025949 Bacteria 9880
21 Ga0207702_10024792 3300026078 Bacteria 4976
22 Ga0207641_10164534 3300026088 Bacteria 2019
23 Ga0207674_10665516 3300026116 Bacteria 1005
24 Ga0265337_1000172 3300028556 Bacteria 33853
25 Ga0265337_1000224 3300028556 Bacteria 30283
26 Ga0265337_1001604 3300028556 Bacteria 11049
27 Ga0265337_1012920 3300028556 Bacteria 2820
28 Ga0265337_1021874 3300028556 Bacteria 1988
29 Ga0265337_1027797 3300028556 Unclassified 1702
30 Ga0265326_10002904 3300028558 Bacteria 5725
31 Ga0265326_10009400 3300028558 Bacteria 2924
32 Ga0265326_10020964 3300028558 Bacteria 1874
33 Ga0265319_1000007 3300028563 Bacteria 217194
34 Ga0265319_1011987 3300028563 Bacteria 3523
35 Ga0265319_1050201 3300028563 Bacteria 1379
36 Ga0265318_10018221 3300028577 Bacteria 2869
37 Ga0265318_10058942 3300028577 Unclassified 1432
38 Ga0265323_10000106 3300028653 Bacteria 48787
39 Ga0265323_10027707 3300028653 Bacteria 2127
40 Ga0265323_10064259 3300028653 Bacteria 1269
41 Ga0265323_10112731 3300028653 Bacteria 891
42 Ga0265336_10000757 3300028666 Bacteria 17176
43 Ga0265336_10018420 3300028666 Bacteria 2263
44 Ga0265338_10000053 3300028800 Bacteria 208184
45 Ga0265338_10000184 3300028800 Bacteria 116834
46 Ga0265338_10000200 3300028800 Bacteria 113123
47 Ga0265338_10000263 3300028800 Bacteria 95638
48 Ga0265338_10000442 3300028800 Bacteria 74078
49 Ga0265338_10002849 3300028800 Bacteria 25270
50 Ga0265338_10003660 3300028800 Bacteria 21408
51 Ga0265338_10008066 3300028800 Bacteria 12880
52 Ga0265338_10009172 3300028800 Bacteria 11867
53 Ga0265338_10022230 3300028800 Bacteria 6574
54 Ga0265338_10034328 3300028800 Bacteria 4905
55 Ga0265338_10051026 3300028800 Bacteria 3731
56 Ga0265338_10072326 3300028800 Bacteria 2944
57 Ga0265338_10125435 3300028800 Bacteria 2038
58 Ga0265338_10131334 3300028800 Bacteria 1976
59 Ga0265338_10180209 3300028800 Bacteria 1611
60 Ga0265338_10238719 3300028800 Unclassified 1347
61 Ga0265338_10288977 3300028800 Bacteria 1195
62 Ga0265338_10356411 3300028800 Unclassified 1050
63 Ga0265338_10361119 3300028800 Bacteria 1042
64 Ga0265324_10000277 3300029957 Bacteria 37796
65 Ga0265324_10004192 3300029957 Bacteria 6599
66 Ga0265324_10016088 3300029957 Bacteria 2740
67 Ga0265324_10018659 3300029957 Bacteria 2505
68 Ga0265324_10021400 3300029957 Unclassified 2319
69 Ga0265324_10033047 3300029957 Unclassified 1807
70 Ga0265324_10040398 3300029957 Bacteria 1615
71 Ga0265324_10047034 3300029957 Bacteria 1485
72 Ga0265324_10061449 3300029957 Bacteria 1284
73 Ga0265330_10059415 3300031235 Unclassified 1665
74 Ga0265320_10001072 3300031240 Bacteria 20244
75 Ga0265320_10001973 3300031240 Bacteria 14502
76 Ga0265320_10003450 3300031240 Bacteria 10630
77 Ga0265320_10008032 3300031240 Bacteria 6497
78 Ga0265320_10010201 3300031240 Bacteria 5610
79 Ga0265320_10037480 3300031240 Bacteria 2441
80 Ga0265325_10005728 3300031241 Bacteria 7630
81 Ga0265325_10092460 3300031241 Unclassified 1489
82 Ga0265325_10100009 3300031241 Bacteria 1421
83 Ga0265340_10004202 3300031247 Bacteria 8076
84 Ga0265340_10004237 3300031247 Bacteria 8039
85 Ga0265340_10009140 3300031247 Bacteria 5328
86 Ga0265340_10053766 3300031247 Bacteria 1944
87 Ga0265340_10183265 3300031247 Unclassified 946
88 Ga0265339_10016542 3300031249 Bacteria 4394
89 Ga0265339_10199963 3300031249 Bacteria 986
90 Ga0265339_10217479 3300031249 Unclassified 936
91 Ga0265339_10239068 3300031249 Unclassified 882
92 Ga0265327_10006114 3300031251 Bacteria 9750
93 Ga0265316_10009003 3300031344 Bacteria 9208
94 Ga0265316_10015268 3300031344 Bacteria 6720
95 Ga0265316_10029626 3300031344 Bacteria 4497
96 Ga0265316_10052608 3300031344 Bacteria 3194
97 Ga0265316_10098460 3300031344 Bacteria 2225
98 Ga0265313_10001258 3300031595 Bacteria 24105
99 Ga0265313_10014680 3300031595 Unclassified 4614
100 Ga0265313_10034046 3300031595 Bacteria 2580
101 Ga0265314_10005918 3300031711 Bacteria 10939
102 Ga0265314_10222755 3300031711 Unclassified 1099
103 Ga0265342_10079155 3300031712 Bacteria 1901
104 Ga0265342_10117610 3300031712 Bacteria 1499
105 Ga0265342_10247133 3300031712 Bacteria 953
106 Ga0373930_0013047 3300034816 Unclassified 1525
107 Ga0373950_0000810 3300034818 Bacteria 3917
108 Ga0373928_0000013 3300035084 Bacteria 30263
109 Ga0373929_0000216 3300035085 Bacteria 10483
110 Ga0373949_0027353 3300035090 Bacteria 1340
111 Ga0373951_0002609 3300035091 Bacteria 4528
112 Ga0373923_0205340 3300035111 Bacteria 912
113 Ga0373932_0000001 3300035112 Bacteria 1459067
114 Ga0373939_0149685 3300035114 Unclassified 848
115 Ga0373953_0166250 3300035117 Bacteria 949
116 Ga0373954_0054679 3300035118 Bacteria 1877
117 Ga0373943_0078419 3300035170 Bacteria 1689
118 Ga0373962_0000060 3300035242 Bacteria 23790
119 Ga0373931_0000002 3300035691 Bacteria 599830
120 Ga0373935_0102442 3300035692 Bacteria 1889
121 Ga0373927_0018109 3300035695 Bacteria 4632
122 Ga0373933_0025603 3300035724 Bacteria 3384
123 Ga0373933_0058097 3300035724 Bacteria 2326
124 Ga0373947_0051250 3300035725 Bacteria 2483
125 Ga0373937_0008304 3300036401 Bacteria 9015
126 Ga0373937_0395384 3300036401 Bacteria 1311
127 Ga0373937_0428781 3300036401 Bacteria 1255
128 Ga0373925_0000497 3300037068 Bacteria 39608
129 Ga0373925_0224693 3300037068 Bacteria 1500
130 Ga0451577_0039787 3300042876 Bacteria 4223
131 Ga0453684_0002148 3300044712 Bacteria 49415
132 Ga0453684_0008084 3300044712 Bacteria 19017
133 Ga0451576_0059387 3300045051 Bacteria 3992
134 Ga0495592_0177500 3300046454 Unclassified 1453
135 Ga0495629_0214200 3300046459 Bacteria 1330
136 Ga0495662_0193476 3300046476 Unclassified 1003
137 Ga0495608_0192919 3300046511 Bacteria 1286
138 Ga0495618_0002756 3300046514 Bacteria 11171
139 Ga0495628_0262734 3300046516 Bacteria 1286
140 Ga0495630_0323520 3300046517 Bacteria 1179
141 Ga0495630_0437981 3300046517 Unclassified 1001
142 Ga0495652_0034828 3300046529 Bacteria 4387
143 Ga0495640_0102236 3300046533 Bacteria 1880
144 Ga0495586_0000686 3300046535 Bacteria 19274
145 Ga0495586_0034373 3300046535 Bacteria 2723
146 Ga0495587_0275478 3300046536 Unclassified 943
147 Ga0495622_0019317 3300046557 Bacteria 3173
148 Ga0495667_0151936 3300046559 Bacteria 1491
149 Ga0495667_0221199 3300046559 Bacteria 1208
150 Ga0495634_0130512 3300046642 Bacteria 1602
151 Ga0495647_0052019 3300046681 Unclassified 1593
152 Ga0495613_0007662 3300046689 Bacteria 8034
153 Ga0495674_0078998 3300047319 Unclassified 2826
154 Ga0495680_0005227 3300047322 Bacteria 12253
155 Ga0495684_0192579 3300047471 Unclassified 1507
156 Ga0501031_0067906 3300049568 Bacteria 2322
157 Ga0501032_0008094 3300049569 Bacteria 7664
158 Ga0501032_0049529 3300049569 Bacteria 2834
159 Ga0501033_0006501 3300049570 Bacteria 9144
160 Ga0501033_0059617 3300049570 Bacteria 2818
161 Ga0501036_0142259 3300049572 Bacteria 2024
162 Ga0501037_0103833 3300049573 Bacteria 2049
163 Ga0501038_0186419 3300049574 Bacteria 1672
164 Ga0501080_0094125 3300049742 Bacteria 2782
165 Ga0501035_0004847 3300049822 Bacteria 12757
166 Ga0501035_0018538 3300049822 Bacteria 6411
167 Ga0501044_0000281 3300049823 Bacteria 64762
168 Ga0501044_0168526 3300049823 Unclassified 2163
169 Ga0501044_0489950 3300049823 Bacteria 1131
170 Ga0500650_0341944 3300053098 Unclassified 656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10092460 Ga0265325_100924602 201
2 3300028653 Ga0265323_10000106 Ga0265323_1000010648 202
3 3300028800 Ga0265338_10008066 Ga0265338_100080666 202
4 3300031344 Ga0265316_10029626 Ga0265316_100296262 202
5 3300031344 Ga0265316_10098460 Ga0265316_100984602 202
6 3300028800 Ga0265338_10002849 Ga0265338_100028494 203
7 3300031712 Ga0265342_10079155 Ga0265342_100791551 203
8 3300053098 Ga0500650_0341944 Ga0500650_0341944_14_631 204
9 3300031247 Ga0265340_10053766 Ga0265340_100537662 206
10 3300028800 Ga0265338_10022230 Ga0265338_100222302 208
11 3300005614 Ga0068856_100104912 Ga0068856_1001049122 211
12 3300028666 Ga0265336_10018420 Ga0265336_100184202 212
13 3300028800 Ga0265338_10180209 Ga0265338_101802092 212
14 3300029957 Ga0265324_10061449 Ga0265324_100614492 212
15 3300031240 Ga0265320_10001973 Ga0265320_100019739 212
16 3300031241 Ga0265325_10100009 Ga0265325_101000092 212
17 3300031249 Ga0265339_10199963 Ga0265339_101999632 212
18 3300029957 Ga0265324_10047034 Ga0265324_100470341 214
19 3300036401 Ga0373937_0428781 Ga0373937_0428781_405_1085 214
20 3300046511 Ga0495608_0192919 Ga0495608_0192919_312_992 214
21 3300046535 Ga0495586_0034373 Ga0495586_0034373_801_1481 214
22 3300046559 Ga0495667_0151936 Ga0495667_0151936_616_1296 214
23 3300035111 Ga0373923_0205340 Ga0373923_0205340_24_770 216
24 3300035118 Ga0373954_0054679 Ga0373954_0054679_353_1099 216
25 3300035724 Ga0373933_0058097 Ga0373933_0058097_1390_2136 216
26 3300036401 Ga0373937_0395384 Ga0373937_0395384_228_974 216
27 3300037068 Ga0373925_0224693 Ga0373925_0224693_54_800 216
28 3300046454 Ga0495592_0177500 Ga0495592_0177500_129_995 216
29 3300046517 Ga0495630_0437981 Ga0495630_0437981_120_986 216
30 3300046529 Ga0495652_0034828 Ga0495652_0034828_1164_2030 216
31 3300046536 Ga0495587_0275478 Ga0495587_0275478_58_924 216
32 3300047319 Ga0495674_0078998 Ga0495674_0078998_78_824 216
33 3300047471 Ga0495684_0192579 Ga0495684_0192579_170_1036 216
34 3300028556 Ga0265337_1001604 Ga0265337_100160410 218
35 3300005614 Ga0068856_100345948 Ga0068856_1003459481 220
36 3300026078 Ga0207702_10024792 Ga0207702_100247926 220
37 3300042876 Ga0451577_0039787 Ga0451577_0039787_1319_2017 220
38 3300044712 Ga0453684_0002148 Ga0453684_0002148_44847_45545 220
39 3300046557 Ga0495622_0019317 Ga0495622_0019317_2073_2750 224
40 3300005841 Ga0068863_100038452 Ga0068863_1000384525 225
41 3300026088 Ga0207641_10164534 Ga0207641_101645343 225
42 3300028558 Ga0265326_10009400 Ga0265326_100094003 225
43 3300028653 Ga0265323_10027707 Ga0265323_100277072 225
44 3300029957 Ga0265324_10004192 Ga0265324_100041924 225
45 3300029957 Ga0265324_10021400 Ga0265324_100214003 225
46 3300031344 Ga0265316_10009003 Ga0265316_100090032 225
47 3300031711 Ga0265314_10222755 Ga0265314_102227551 225
48 3300034816 Ga0373930_0013047 Ga0373930_0013047_481_1158 225
49 3300034818 Ga0373950_0000810 Ga0373950_0000810_2452_3129 225
50 3300035084 Ga0373928_0000013 Ga0373928_0000013_4891_5568 225
51 3300035085 Ga0373929_0000216 Ga0373929_0000216_7456_8133 225
52 3300035090 Ga0373949_0027353 Ga0373949_0027353_81_758 225
53 3300035091 Ga0373951_0002609 Ga0373951_0002609_3614_4291 225
54 3300035112 Ga0373932_0000001 Ga0373932_0000001_966347_967024 225
55 3300035114 Ga0373939_0149685 Ga0373939_0149685_34_711 225
56 3300035170 Ga0373943_0078419 Ga0373943_0078419_973_1650 225
57 3300035242 Ga0373962_0000060 Ga0373962_0000060_19811_20488 225
58 3300035691 Ga0373931_0000002 Ga0373931_0000002_528374_529051 225
59 3300035692 Ga0373935_0102442 Ga0373935_0102442_243_920 225
60 3300035695 Ga0373927_0018109 Ga0373927_0018109_311_988 225
61 3300035725 Ga0373947_0051250 Ga0373947_0051250_1613_2290 225
62 3300037068 Ga0373925_0000497 Ga0373925_0000497_25642_26319 225
63 3300005439 Ga0070711_100000512 Ga0070711_10000051219 226
64 3300009176 Ga0105242_10023592 Ga0105242_100235924 226
65 3300025913 Ga0207695_10183419 Ga0207695_101834192 226
66 3300025916 Ga0207663_10001668 Ga0207663_100016683 226
67 3300025924 Ga0207694_10014836 Ga0207694_100148366 226
68 3300028556 Ga0265337_1012920 Ga0265337_10129202 226
69 3300028556 Ga0265337_1021874 Ga0265337_10218742 226
70 3300028558 Ga0265326_10002904 Ga0265326_100029043 226
71 3300028558 Ga0265326_10020964 Ga0265326_100209642 226
72 3300028563 Ga0265319_1011987 Ga0265319_10119872 226
73 3300028563 Ga0265319_1050201 Ga0265319_10502012 226
74 3300028577 Ga0265318_10018221 Ga0265318_100182212 226
75 3300028653 Ga0265323_10064259 Ga0265323_100642592 226
76 3300028653 Ga0265323_10112731 Ga0265323_101127311 226
77 3300028800 Ga0265338_10000053 Ga0265338_1000005333 226
78 3300028800 Ga0265338_10000200 Ga0265338_1000020024 226
79 3300028800 Ga0265338_10000442 Ga0265338_1000044264 226
80 3300028800 Ga0265338_10009172 Ga0265338_100091725 226
81 3300028800 Ga0265338_10034328 Ga0265338_100343286 226
82 3300028800 Ga0265338_10051026 Ga0265338_100510262 226
83 3300028800 Ga0265338_10072326 Ga0265338_100723262 226
84 3300028800 Ga0265338_10125435 Ga0265338_101254352 226
85 3300028800 Ga0265338_10131334 Ga0265338_101313342 226
86 3300028800 Ga0265338_10238719 Ga0265338_102387192 226
87 3300028800 Ga0265338_10356411 Ga0265338_103564112 226
88 3300029957 Ga0265324_10000277 Ga0265324_1000027715 226
89 3300029957 Ga0265324_10016088 Ga0265324_100160881 226
90 3300029957 Ga0265324_10018659 Ga0265324_100186592 226
91 3300031235 Ga0265330_10059415 Ga0265330_100594152 226
92 3300031241 Ga0265325_10005728 Ga0265325_100057287 226
93 3300031247 Ga0265340_10004202 Ga0265340_100042026 226
94 3300031247 Ga0265340_10004237 Ga0265340_100042373 226
95 3300031247 Ga0265340_10009140 Ga0265340_100091402 226
96 3300031247 Ga0265340_10183265 Ga0265340_101832652 226
97 3300031249 Ga0265339_10016542 Ga0265339_100165424 226
98 3300031249 Ga0265339_10217479 Ga0265339_102174791 226
99 3300031249 Ga0265339_10239068 Ga0265339_102390682 226
100 3300031344 Ga0265316_10015268 Ga0265316_100152682 226
101 3300031344 Ga0265316_10052608 Ga0265316_100526085 226
102 3300031595 Ga0265313_10001258 Ga0265313_1000125823 226
103 3300031595 Ga0265313_10014680 Ga0265313_100146802 226
104 3300031711 Ga0265314_10005918 Ga0265314_100059186 226
105 3300031712 Ga0265342_10117610 Ga0265342_101176102 226
106 3300035724 Ga0373933_0025603 Ga0373933_0025603_521_1222 226
107 3300036401 Ga0373937_0008304 Ga0373937_0008304_459_1160 226
108 3300045051 Ga0451576_0059387 Ga0451576_0059387_2558_3256 226
109 3300046459 Ga0495629_0214200 Ga0495629_0214200_414_1115 226
110 3300046476 Ga0495662_0193476 Ga0495662_0193476_25_726 226
111 3300046514 Ga0495618_0002756 Ga0495618_0002756_9562_10263 226
112 3300046516 Ga0495628_0262734 Ga0495628_0262734_521_1222 226
113 3300046517 Ga0495630_0323520 Ga0495630_0323520_48_749 226
114 3300046533 Ga0495640_0102236 Ga0495640_0102236_1076_1777 226
115 3300046535 Ga0495586_0000686 Ga0495586_0000686_11080_11781 226
116 3300046559 Ga0495667_0221199 Ga0495667_0221199_441_1142 226
117 3300046642 Ga0495634_0130512 Ga0495634_0130512_866_1567 226
118 3300046681 Ga0495647_0052019 Ga0495647_0052019_785_1486 226
119 3300046689 Ga0495613_0007662 Ga0495613_0007662_1271_1972 226
120 3300047322 Ga0495680_0005227 Ga0495680_0005227_10948_11649 226
121 3300049568 Ga0501031_0067906 Ga0501031_0067906_84_764 226
122 3300049569 Ga0501032_0008094 Ga0501032_0008094_199_879 226
123 3300049569 Ga0501032_0049529 Ga0501032_0049529_467_1147 226
124 3300049570 Ga0501033_0006501 Ga0501033_0006501_1018_1698 226
125 3300049570 Ga0501033_0059617 Ga0501033_0059617_354_1034 226
126 3300049572 Ga0501036_0142259 Ga0501036_0142259_164_844 226
127 3300049573 Ga0501037_0103833 Ga0501037_0103833_1130_1810 226
128 3300049574 Ga0501038_0186419 Ga0501038_0186419_645_1325 226
129 3300049742 Ga0501080_0094125 Ga0501080_0094125_91_771 226
130 3300049822 Ga0501035_0004847 Ga0501035_0004847_5809_6489 226
131 3300049822 Ga0501035_0018538 Ga0501035_0018538_5375_6055 226
132 3300049823 Ga0501044_0000281 Ga0501044_0000281_25363_26043 226
133 3300049823 Ga0501044_0168526 Ga0501044_0168526_1387_2067 226
134 3300049823 Ga0501044_0489950 Ga0501044_0489950_356_1036 226
135 3300003323 rootH1_10195635 rootH1_101956352 227
136 3300005340 Ga0070689_100119218 Ga0070689_1001192182 227
137 3300005340 Ga0070689_100520666 Ga0070689_1005206661 227
138 3300005466 Ga0070685_10099326 Ga0070685_100993262 227
139 3300005617 Ga0068859_100603830 Ga0068859_1006038302 227
140 3300006931 Ga0097620_100603886 Ga0097620_1006038862 227
141 3300009545 Ga0105237_11010064 Ga0105237_110100641 227
142 3300013296 Ga0157374_10511188 Ga0157374_105111881 227
143 3300014969 Ga0157376_11081421 Ga0157376_110814212 227
144 3300025941 Ga0207711_10140173 Ga0207711_101401732 227
145 3300025949 Ga0207667_10012282 Ga0207667_1001228210 227
146 3300026116 Ga0207674_10665516 Ga0207674_106655162 227
147 3300028556 Ga0265337_1000172 Ga0265337_100017219 227
148 3300028556 Ga0265337_1000224 Ga0265337_100022420 227
149 3300028556 Ga0265337_1027797 Ga0265337_10277972 227
150 3300028563 Ga0265319_1000007 Ga0265319_100000718 227
151 3300028577 Ga0265318_10058942 Ga0265318_100589422 227
152 3300028666 Ga0265336_10000757 Ga0265336_100007576 227
153 3300028800 Ga0265338_10000184 Ga0265338_1000018468 227
154 3300028800 Ga0265338_10000263 Ga0265338_1000026320 227
155 3300028800 Ga0265338_10003660 Ga0265338_1000366010 227
156 3300028800 Ga0265338_10288977 Ga0265338_102889772 227
157 3300028800 Ga0265338_10361119 Ga0265338_103611191 227
158 3300029957 Ga0265324_10033047 Ga0265324_100330472 227
159 3300029957 Ga0265324_10040398 Ga0265324_100403982 227
160 3300031240 Ga0265320_10001072 Ga0265320_1000107215 227
161 3300031240 Ga0265320_10003450 Ga0265320_100034507 227
162 3300031240 Ga0265320_10008032 Ga0265320_100080322 227
163 3300031240 Ga0265320_10010201 Ga0265320_100102016 227
164 3300031240 Ga0265320_10037480 Ga0265320_100374802 227
165 3300031251 Ga0265327_10006114 Ga0265327_100061145 227
166 3300031595 Ga0265313_10034046 Ga0265313_100340463 227
167 3300031712 Ga0265342_10247133 Ga0265342_102471331 227
168 3300035117 Ga0373953_0166250 Ga0373953_0166250_10_756 227
169 3300044712 Ga0453684_0008084 Ga0453684_0008084_11758_12447 227
170 3300003320 rootH2_10082941 rootH2_100829414 229

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kl9-assembly1.cif.gz_E structure of the sars-cov-2 s 6p trimer in complex with the ace2 protein decoy, ctc-445.2 (state 4) 0.6531 3 119
6s18-assembly1.cif.gz_A ligand binding domain of the p. putida receptor pcay_pp in complex with glycerol 0.5998 9 119
3va9-assembly1.cif.gz_A crystal structure of the rhodopseudomonas palustris histidine kinase hk9 sensor domain 0.5838 15 123
1y4c-assembly1.cif.gz_A designed helical protein fusion mbp 0.5679 14 94
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.5646 3 114
ID Description Score Start End Superfamily
4k0dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6899 15 123 1.20.120.1730
2kgxA00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6561 13 119 1.20.1420.10
af_Q54K81_1745_1895_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6197 3 126 1.20.1420.10
af_Q1LU92_154_264_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6129 27 126 1.20.120.230
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.5835 9 119 1.20.120.660
ID Description Score Start End GO Terms
AF-A0A7V4IHG3-F1-model_v4 DUF4153 domain-containing protein 0.9615 1 229 GO:0016020
AF-A0A7V4IHG3-F1-model_v4 DUF4153 domain-containing protein 0.9573 1 229 GO:0016020
AF-A0A7Y4QIW9-F1-model_v4 Uncharacterized protein 0.9558 1 229 GO:0016020
AF-A0A7Y4QIW9-F1-model_v4 Uncharacterized protein 0.9517 1 229 GO:0016020
AF-A0A6N6Q4A7-F1-model_v4 DUF975 family protein 0.9354 1 228 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.54 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map