F257958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 171 | 138 | 171 | 72 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10267815|Ga0065707_102678152 |
| Length | 84 |
| Sequence | MAYNLHFYLLFINSNMRTVGIILIVVGIAMLLFRGFSVKTEEKVIDVGPLEVNKKENKWIGWPVYAGGIAIVAGLIMVVADRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 73 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 74 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 77 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 78 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 79 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 80 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 81 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 84 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 85 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 86 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 87 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 88 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 89 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 90 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 91 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 92 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 93 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 94 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 95 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 96 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 102 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 110 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 111 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 112 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 113 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 114 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 115 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 116 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 118 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 119 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 122 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 124 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 125 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 126 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 127 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 128 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 129 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 130 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 131 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 132 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 136 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 137 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 138 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 1.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.7 |
| Nodule | 0 |
| Rhizoplane | 2.34 |
| Rhizosphere | 79.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006778J45830_1121761 | 3300003162 | Bacteria | 693 |
| 2 | rootH1_10003061 | 3300003316 | Bacteria | 11861 |
| 3 | rootH2_10018356 | 3300003320 | Bacteria | 38384 |
| 4 | rootL2_10014731 | 3300003322 | Bacteria | 30193 |
| 5 | rootL2_10050746 | 3300003322 | Bacteria | 1827 |
| 6 | rootL2_10288607 | 3300003322 | Bacteria | 2461 |
| 7 | rootH1_10002485 | 3300003323 | Bacteria | 66401 |
| 8 | rootH1_10039020 | 3300003323 | Bacteria | 13908 |
| 9 | rootH1_10152459 | 3300003323 | Bacteria | 1591 |
| 10 | Ga0065707_10267815 | 3300005295 | Bacteria | 1079 |
| 11 | Ga0070658_11790423 | 3300005327 | Unclassified | 531 |
| 12 | Ga0070666_10000424 | 3300005335 | Bacteria | 26177 |
| 13 | Ga0070682_101070891 | 3300005337 | Bacteria | 673 |
| 14 | Ga0068868_100076430 | 3300005338 | Bacteria | 2677 |
| 15 | Ga0070668_101265576 | 3300005347 | Bacteria | 670 |
| 16 | Ga0070671_100241440 | 3300005355 | Bacteria | 1534 |
| 17 | Ga0070673_100342387 | 3300005364 | Bacteria | 1325 |
| 18 | Ga0070688_100609872 | 3300005365 | Bacteria | 836 |
| 19 | Ga0070667_100021134 | 3300005367 | Bacteria | 5407 |
| 20 | Ga0070667_100545531 | 3300005367 | Unclassified | 1065 |
| 21 | Ga0068867_100098367 | 3300005459 | Bacteria | 2231 |
| 22 | Ga0070685_10437410 | 3300005466 | Bacteria | 913 |
| 23 | Ga0068853_101328434 | 3300005539 | Bacteria | 695 |
| 24 | Ga0070672_101286154 | 3300005543 | Bacteria | 653 |
| 25 | Ga0070704_101002971 | 3300005549 | Bacteria | 755 |
| 26 | Ga0068852_100163009 | 3300005616 | Unclassified | 2083 |
| 27 | Ga0068852_100942044 | 3300005616 | Bacteria | 881 |
| 28 | Ga0068859_100000960 | 3300005617 | Bacteria | 29521 |
| 29 | Ga0068864_100009103 | 3300005618 | Bacteria | 8185 |
| 30 | Ga0068864_100800336 | 3300005618 | Bacteria | 926 |
| 31 | Ga0068870_10838273 | 3300005840 | Bacteria | 645 |
| 32 | Ga0068863_100013476 | 3300005841 | Bacteria | 7886 |
| 33 | Ga0068858_100010191 | 3300005842 | Bacteria | 8921 |
| 34 | Ga0068862_100897581 | 3300005844 | Bacteria | 871 |
| 35 | Ga0070717_10824104 | 3300006028 | Bacteria | 844 |
| 36 | Ga0097620_100000960 | 3300006931 | Bacteria | 29521 |
| 37 | Ga0097620_100800241 | 3300006931 | Bacteria | 1030 |
| 38 | Ga0111539_10026554 | 3300009094 | Bacteria | 7079 |
| 39 | Ga0105247_10005369 | 3300009101 | Bacteria | 8077 |
| 40 | Ga0105243_10287829 | 3300009148 | Unclassified | 1483 |
| 41 | Ga0105241_10001471 | 3300009174 | Bacteria | 18063 |
| 42 | Ga0105237_10024905 | 3300009545 | Bacteria | 6122 |
| 43 | Ga0105249_10010593 | 3300009553 | Bacteria | 8099 |
| 44 | Ga0105249_10436066 | 3300009553 | Bacteria | 1347 |
| 45 | Ga0105249_11266401 | 3300009553 | Bacteria | 809 |
| 46 | Ga0105239_10236720 | 3300010375 | Bacteria | 2049 |
| 47 | Ga0105246_10033931 | 3300011119 | Bacteria | 3395 |
| 48 | Ga0105246_10089338 | 3300011119 | Bacteria | 2216 |
| 49 | Ga0157371_10520801 | 3300013102 | Bacteria | 879 |
| 50 | Ga0157370_10168989 | 3300013104 | Bacteria | 2033 |
| 51 | Ga0157370_11491619 | 3300013104 | Bacteria | 608 |
| 52 | Ga0157378_10067643 | 3300013297 | Bacteria | 3202 |
| 53 | Ga0157378_12458772 | 3300013297 | Bacteria | 573 |
| 54 | Ga0163162_10000414 | 3300013306 | Bacteria | 39202 |
| 55 | Ga0157372_11304466 | 3300013307 | Bacteria | 838 |
| 56 | Ga0157375_10116240 | 3300013308 | Bacteria | 2779 |
| 57 | Ga0157375_10639334 | 3300013308 | Bacteria | 1221 |
| 58 | Ga0163163_10167411 | 3300014325 | Bacteria | 2244 |
| 59 | Ga0157380_10027864 | 3300014326 | Bacteria | 4302 |
| 60 | Ga0157380_10566056 | 3300014326 | Bacteria | 1118 |
| 61 | Ga0157379_10199586 | 3300014968 | Unclassified | 1809 |
| 62 | Ga0157376_10132233 | 3300014969 | Bacteria | 2228 |
| 63 | Ga0157376_11446912 | 3300014969 | Bacteria | 719 |
| 64 | Ga0209050_1074647 | 3300025298 | Unclassified | 744 |
| 65 | Ga0209257_1035452 | 3300025304 | Bacteria | 1544 |
| 66 | Ga0207710_10040263 | 3300025900 | Unclassified | 2070 |
| 67 | Ga0207680_10000036 | 3300025903 | Bacteria | 73025 |
| 68 | Ga0207654_10001486 | 3300025911 | Bacteria | 12386 |
| 69 | Ga0207671_10179606 | 3300025914 | Unclassified | 1647 |
| 70 | Ga0207681_11099287 | 3300025923 | Bacteria | 668 |
| 71 | Ga0207644_10732658 | 3300025931 | Bacteria | 825 |
| 72 | Ga0207711_11422932 | 3300025941 | Bacteria | 636 |
| 73 | Ga0207689_10000360 | 3300025942 | Bacteria | 42854 |
| 74 | Ga0207651_10052320 | 3300025960 | Bacteria | 2784 |
| 75 | Ga0207712_10331108 | 3300025961 | Bacteria | 1260 |
| 76 | Ga0207712_10475211 | 3300025961 | Bacteria | 1064 |
| 77 | Ga0207712_11865187 | 3300025961 | Bacteria | 538 |
| 78 | Ga0207658_10018281 | 3300025986 | Bacteria | 4838 |
| 79 | Ga0207677_10074120 | 3300026023 | Bacteria | 2414 |
| 80 | Ga0207703_10011813 | 3300026035 | Bacteria | 6799 |
| 81 | Ga0207639_10491350 | 3300026041 | Bacteria | 1120 |
| 82 | Ga0207641_10005104 | 3300026088 | Bacteria | 11248 |
| 83 | Ga0207648_10450434 | 3300026089 | Bacteria | 1172 |
| 84 | Ga0207648_10958357 | 3300026089 | Bacteria | 800 |
| 85 | Ga0207676_10003780 | 3300026095 | Bacteria | 10698 |
| 86 | Ga0207676_11186707 | 3300026095 | Bacteria | 756 |
| 87 | Ga0207675_100636713 | 3300026118 | Bacteria | 1072 |
| 88 | Ga0207698_10134530 | 3300026142 | Unclassified | 2119 |
| 89 | Ga0207698_10265268 | 3300026142 | Bacteria | 1580 |
| 90 | Ga0207428_10088180 | 3300027907 | Bacteria | 2413 |
| 91 | Ga0268265_12647992 | 3300028380 | Bacteria | 507 |
| 92 | Ga0268264_10001262 | 3300028381 | Bacteria | 24026 |
| 93 | Ga0316177_1173040 | 3300030731 | Bacteria | 868 |
| 94 | Ga0307513_10390187 | 3300031456 | Bacteria | 1129 |
| 95 | Ga0307509_10090609 | 3300031507 | Unclassified | 3133 |
| 96 | Ga0307408_100039782 | 3300031548 | Bacteria | 3326 |
| 97 | Ga0307413_11919223 | 3300031824 | Bacteria | 532 |
| 98 | Ga0307406_10059623 | 3300031901 | Bacteria | 2458 |
| 99 | Ga0307414_10026803 | 3300032004 | Bacteria | 3714 |
| 100 | Ga0307414_10999347 | 3300032004 | Bacteria | 770 |
| 101 | Ga0307411_11419952 | 3300032005 | Bacteria | 636 |
| 102 | Ga0307415_102242401 | 3300032126 | Bacteria | 535 |
| 103 | Ga0395899_0158963 | 3300037312 | Bacteria | 1598 |
| 104 | Ga0395901_0016621 | 3300038443 | Bacteria | 7497 |
| 105 | Ga0439447_065641 | 3300041407 | Bacteria | 849 |
| 106 | Ga0451791_0968504 | 3300041451 | Bacteria | 710 |
| 107 | Ga0451795_1322993 | 3300041456 | Unclassified | 508 |
| 108 | Ga0451807_1297969 | 3300041486 | Bacteria | 550 |
| 109 | Ga0451807_1457053 | 3300041486 | Unclassified | 510 |
| 110 | Ga0451853_0620789 | 3300041512 | Unclassified | 618 |
| 111 | Ga0439431_0049632 | 3300041997 | Bacteria | 1086 |
| 112 | Ga0439431_0102997 | 3300041997 | Bacteria | 786 |
| 113 | Ga0439442_048066 | 3300042002 | Bacteria | 899 |
| 114 | Ga0439449_0208938 | 3300042007 | Bacteria | 731 |
| 115 | Ga0439457_062394 | 3300042014 | Bacteria | 845 |
| 116 | Ga0450894_026638 | 3300042131 | Bacteria | 795 |
| 117 | Ga0450899_006418 | 3300042135 | Bacteria | 1274 |
| 118 | Ga0439434_0013029 | 3300042435 | Bacteria | 2466 |
| 119 | Ga0466965_0209264 | 3300044683 | Bacteria | 1037 |
| 120 | Ga0495632_0471630 | 3300046519 | Bacteria | 543 |
| 121 | Ga0495643_0130642 | 3300046522 | Unclassified | 1261 |
| 122 | Ga0495597_0345115 | 3300046542 | Bacteria | 572 |
| 123 | Ga0495625_0127184 | 3300046660 | Unclassified | 1729 |
| 124 | Ga0495686_0016014 | 3300047472 | Bacteria | 5097 |
| 125 | Ga0495686_0040374 | 3300047472 | Bacteria | 2976 |
| 126 | Ga0501300_001636 | 3300049523 | Bacteria | 3353 |
| 127 | Ga0501034_0032051 | 3300049571 | Bacteria | 5339 |
| 128 | Ga0501034_0618984 | 3300049571 | Unclassified | 987 |
| 129 | Ga0501034_1596677 | 3300049571 | Unclassified | 525 |
| 130 | Ga0501036_0666453 | 3300049572 | Bacteria | 861 |
| 131 | Ga0501037_0010051 | 3300049573 | Bacteria | 6942 |
| 132 | Ga0501039_0460986 | 3300049575 | Unclassified | 998 |
| 133 | Ga0501043_0021306 | 3300049579 | Bacteria | 5081 |
| 134 | Ga0501043_0062675 | 3300049579 | Bacteria | 2920 |
| 135 | Ga0501047_0062425 | 3300049581 | Bacteria | 3594 |
| 136 | Ga0501047_0693762 | 3300049581 | Bacteria | 836 |
| 137 | Ga0501047_0908431 | 3300049581 | Unclassified | 694 |
| 138 | Ga0501048_0158975 | 3300049582 | Bacteria | 1599 |
| 139 | Ga0501202_002985 | 3300049652 | Bacteria | 2873 |
| 140 | Ga0501210_015878 | 3300049657 | Unclassified | 664 |
| 141 | Ga0501217_002986 | 3300049661 | Bacteria | 3387 |
| 142 | Ga0501236_000147 | 3300049670 | Bacteria | 7220 |
| 143 | Ga0501247_002266 | 3300049677 | Unclassified | 1986 |
| 144 | Ga0501257_033142 | 3300049686 | Bacteria | 1250 |
| 145 | Ga0501261_095016 | 3300049690 | Unclassified | 559 |
| 146 | Ga0501080_1316606 | 3300049742 | Unclassified | 618 |
| 147 | Ga0501264_000007 | 3300049761 | Bacteria | 29622 |
| 148 | Ga0501271_010854 | 3300049768 | Bacteria | 968 |
| 149 | Ga0501035_0115187 | 3300049822 | Bacteria | 2353 |
| 150 | Ga0501044_0018114 | 3300049823 | Bacteria | 7552 |
| 151 | nmdc:mga0k408_260290_c1 | 3300050493 | Bacteria | 1036 |
| 152 | nmdc:mga0k408_66927_c1 | 3300050493 | Bacteria | 2093 |
| 153 | nmdc:mga08y16_12569_c1 | 3300050511 | Bacteria | 8907 |
| 154 | nmdc:mga08y16_1269666_c1 | 3300050511 | Bacteria | 704 |
| 155 | Ga0500578_0553468 | 3300053086 | Unclassified | 639 |
| 156 | Ga0500644_0035621 | 3300053088 | Bacteria | 1614 |
| 157 | Ga0500650_0478938 | 3300053098 | Unclassified | 531 |
| 158 | Ga0500660_126468 | 3300053100 | Bacteria | 1051 |
| 159 | Ga0500569_044715 | 3300053109 | Bacteria | 1312 |
| 160 | Ga0500607_046087 | 3300053121 | Bacteria | 2338 |
| 161 | Ga0500652_106383 | 3300053131 | Bacteria | 1173 |
| 162 | Ga0500655_009793 | 3300053133 | Unclassified | 1730 |
| 163 | Ga0500658_0128985 | 3300053134 | Bacteria | 1126 |
| 164 | Ga0500561_0169322 | 3300053137 | Unclassified | 685 |
| 165 | Ga0500577_0006065 | 3300053142 | Bacteria | 3303 |
| 166 | Ga0500616_0000024 | 3300053153 | Bacteria | 455811 |
| 167 | Ga0500616_0025323 | 3300053153 | Bacteria | 3292 |
| 168 | Ga0500622_0093339 | 3300053156 | Bacteria | 1490 |
| 169 | Ga0500633_0045585 | 3300053160 | Bacteria | 1494 |
| 170 | Ga0500645_170843 | 3300053730 | Bacteria | 594 |
| 171 | Ga0587076_075338 | 3300059645 | Bacteria | 709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10027864 | Ga0157380_100278644 | 60 |
| 2 | 3300003162 | Ga0006778J45830_1121761 | Ga0006778J45830_11217613 | 69 |
| 3 | 3300003316 | rootH1_10003061 | rootH1_100030614 | 69 |
| 4 | 3300003320 | rootH2_10018356 | rootH2_1001835626 | 69 |
| 5 | 3300003322 | rootL2_10014731 | rootL2_1001473116 | 69 |
| 6 | 3300003322 | rootL2_10050746 | rootL2_100507463 | 69 |
| 7 | 3300003322 | rootL2_10288607 | rootL2_102886073 | 69 |
| 8 | 3300003323 | rootH1_10002485 | rootH1_1000248534 | 69 |
| 9 | 3300003323 | rootH1_10039020 | rootH1_1003902012 | 69 |
| 10 | 3300003323 | rootH1_10152459 | rootH1_101524592 | 69 |
| 11 | 3300005295 | Ga0065707_10267815 | Ga0065707_102678152 | 69 |
| 12 | 3300005327 | Ga0070658_11790423 | Ga0070658_117904232 | 69 |
| 13 | 3300005335 | Ga0070666_10000424 | Ga0070666_1000042411 | 69 |
| 14 | 3300005337 | Ga0070682_101070891 | Ga0070682_1010708912 | 69 |
| 15 | 3300005338 | Ga0068868_100076430 | Ga0068868_1000764302 | 69 |
| 16 | 3300005347 | Ga0070668_101265576 | Ga0070668_1012655761 | 69 |
| 17 | 3300005355 | Ga0070671_100241440 | Ga0070671_1002414404 | 69 |
| 18 | 3300005364 | Ga0070673_100342387 | Ga0070673_1003423872 | 69 |
| 19 | 3300005365 | Ga0070688_100609872 | Ga0070688_1006098721 | 69 |
| 20 | 3300005367 | Ga0070667_100021134 | Ga0070667_1000211342 | 69 |
| 21 | 3300005367 | Ga0070667_100545531 | Ga0070667_1005455312 | 69 |
| 22 | 3300005459 | Ga0068867_100098367 | Ga0068867_1000983674 | 69 |
| 23 | 3300005466 | Ga0070685_10437410 | Ga0070685_104374102 | 69 |
| 24 | 3300005539 | Ga0068853_101328434 | Ga0068853_1013284342 | 69 |
| 25 | 3300005543 | Ga0070672_101286154 | Ga0070672_1012861541 | 69 |
| 26 | 3300005549 | Ga0070704_101002971 | Ga0070704_1010029711 | 69 |
| 27 | 3300005616 | Ga0068852_100163009 | Ga0068852_1001630094 | 69 |
| 28 | 3300005616 | Ga0068852_100942044 | Ga0068852_1009420442 | 69 |
| 29 | 3300005617 | Ga0068859_100000960 | Ga0068859_10000096017 | 69 |
| 30 | 3300005618 | Ga0068864_100009103 | Ga0068864_1000091035 | 69 |
| 31 | 3300005618 | Ga0068864_100800336 | Ga0068864_1008003362 | 69 |
| 32 | 3300005840 | Ga0068870_10838273 | Ga0068870_108382732 | 69 |
| 33 | 3300005841 | Ga0068863_100013476 | Ga0068863_1000134767 | 69 |
| 34 | 3300005842 | Ga0068858_100010191 | Ga0068858_1000101917 | 69 |
| 35 | 3300005844 | Ga0068862_100897581 | Ga0068862_1008975812 | 69 |
| 36 | 3300006028 | Ga0070717_10824104 | Ga0070717_108241042 | 69 |
| 37 | 3300006931 | Ga0097620_100000960 | Ga0097620_10000096017 | 69 |
| 38 | 3300006931 | Ga0097620_100800241 | Ga0097620_1008002412 | 69 |
| 39 | 3300009094 | Ga0111539_10026554 | Ga0111539_1002655410 | 69 |
| 40 | 3300009101 | Ga0105247_10005369 | Ga0105247_100053698 | 69 |
| 41 | 3300009148 | Ga0105243_10287829 | Ga0105243_102878292 | 69 |
| 42 | 3300009174 | Ga0105241_10001471 | Ga0105241_1000147115 | 69 |
| 43 | 3300009545 | Ga0105237_10024905 | Ga0105237_100249053 | 69 |
| 44 | 3300009553 | Ga0105249_10010593 | Ga0105249_100105934 | 69 |
| 45 | 3300009553 | Ga0105249_10436066 | Ga0105249_104360662 | 69 |
| 46 | 3300009553 | Ga0105249_11266401 | Ga0105249_112664011 | 69 |
| 47 | 3300010375 | Ga0105239_10236720 | Ga0105239_102367204 | 69 |
| 48 | 3300011119 | Ga0105246_10033931 | Ga0105246_100339312 | 69 |
| 49 | 3300011119 | Ga0105246_10089338 | Ga0105246_100893383 | 69 |
| 50 | 3300013102 | Ga0157371_10520801 | Ga0157371_105208012 | 69 |
| 51 | 3300013104 | Ga0157370_10168989 | Ga0157370_101689892 | 69 |
| 52 | 3300013104 | Ga0157370_11491619 | Ga0157370_114916192 | 69 |
| 53 | 3300013297 | Ga0157378_10067643 | Ga0157378_100676432 | 69 |
| 54 | 3300013297 | Ga0157378_12458772 | Ga0157378_124587721 | 69 |
| 55 | 3300013306 | Ga0163162_10000414 | Ga0163162_100004147 | 69 |
| 56 | 3300013307 | Ga0157372_11304466 | Ga0157372_113044661 | 69 |
| 57 | 3300013308 | Ga0157375_10116240 | Ga0157375_101162403 | 69 |
| 58 | 3300013308 | Ga0157375_10639334 | Ga0157375_106393343 | 69 |
| 59 | 3300014325 | Ga0163163_10167411 | Ga0163163_101674112 | 69 |
| 60 | 3300014326 | Ga0157380_10566056 | Ga0157380_105660562 | 69 |
| 61 | 3300014968 | Ga0157379_10199586 | Ga0157379_101995862 | 69 |
| 62 | 3300014969 | Ga0157376_10132233 | Ga0157376_101322334 | 69 |
| 63 | 3300014969 | Ga0157376_11446912 | Ga0157376_114469121 | 69 |
| 64 | 3300025298 | Ga0209050_1074647 | Ga0209050_10746471 | 69 |
| 65 | 3300025304 | Ga0209257_1035452 | Ga0209257_10354521 | 69 |
| 66 | 3300025900 | Ga0207710_10040263 | Ga0207710_100402632 | 69 |
| 67 | 3300025903 | Ga0207680_10000036 | Ga0207680_1000003655 | 69 |
| 68 | 3300025911 | Ga0207654_10001486 | Ga0207654_1000148611 | 69 |
| 69 | 3300025914 | Ga0207671_10179606 | Ga0207671_101796062 | 69 |
| 70 | 3300025923 | Ga0207681_11099287 | Ga0207681_110992872 | 69 |
| 71 | 3300025931 | Ga0207644_10732658 | Ga0207644_107326582 | 69 |
| 72 | 3300025941 | Ga0207711_11422932 | Ga0207711_114229322 | 69 |
| 73 | 3300025942 | Ga0207689_10000360 | Ga0207689_100003605 | 69 |
| 74 | 3300025960 | Ga0207651_10052320 | Ga0207651_100523204 | 69 |
| 75 | 3300025961 | Ga0207712_10331108 | Ga0207712_103311083 | 69 |
| 76 | 3300025961 | Ga0207712_10475211 | Ga0207712_104752112 | 69 |
| 77 | 3300025961 | Ga0207712_11865187 | Ga0207712_118651871 | 69 |
| 78 | 3300025986 | Ga0207658_10018281 | Ga0207658_100182815 | 69 |
| 79 | 3300026023 | Ga0207677_10074120 | Ga0207677_100741203 | 69 |
| 80 | 3300026035 | Ga0207703_10011813 | Ga0207703_100118135 | 69 |
| 81 | 3300026041 | Ga0207639_10491350 | Ga0207639_104913504 | 69 |
| 82 | 3300026088 | Ga0207641_10005104 | Ga0207641_100051047 | 69 |
| 83 | 3300026089 | Ga0207648_10450434 | Ga0207648_104504342 | 69 |
| 84 | 3300026089 | Ga0207648_10958357 | Ga0207648_109583572 | 69 |
| 85 | 3300026095 | Ga0207676_10003780 | Ga0207676_100037805 | 69 |
| 86 | 3300026095 | Ga0207676_11186707 | Ga0207676_111867072 | 69 |
| 87 | 3300026118 | Ga0207675_100636713 | Ga0207675_1006367131 | 69 |
| 88 | 3300026142 | Ga0207698_10134530 | Ga0207698_101345302 | 69 |
| 89 | 3300026142 | Ga0207698_10265268 | Ga0207698_102652682 | 69 |
| 90 | 3300027907 | Ga0207428_10088180 | Ga0207428_100881802 | 69 |
| 91 | 3300028380 | Ga0268265_12647992 | Ga0268265_126479921 | 69 |
| 92 | 3300028381 | Ga0268264_10001262 | Ga0268264_100012628 | 69 |
| 93 | 3300030731 | Ga0316177_1173040 | Ga0316177_11730402 | 69 |
| 94 | 3300031456 | Ga0307513_10390187 | Ga0307513_103901872 | 69 |
| 95 | 3300031507 | Ga0307509_10090609 | Ga0307509_100906092 | 69 |
| 96 | 3300031548 | Ga0307408_100039782 | Ga0307408_1000397824 | 69 |
| 97 | 3300031824 | Ga0307413_11919223 | Ga0307413_119192231 | 69 |
| 98 | 3300031901 | Ga0307406_10059623 | Ga0307406_100596233 | 69 |
| 99 | 3300032004 | Ga0307414_10026803 | Ga0307414_100268035 | 69 |
| 100 | 3300032004 | Ga0307414_10999347 | Ga0307414_109993472 | 69 |
| 101 | 3300032005 | Ga0307411_11419952 | Ga0307411_114199522 | 69 |
| 102 | 3300032126 | Ga0307415_102242401 | Ga0307415_1022424012 | 69 |
| 103 | 3300037312 | Ga0395899_0158963 | Ga0395899_0158963_561_779 | 69 |
| 104 | 3300038443 | Ga0395901_0016621 | Ga0395901_0016621_6601_6816 | 69 |
| 105 | 3300041407 | Ga0439447_065641 | Ga0439447_065641_493_702 | 69 |
| 106 | 3300041451 | Ga0451791_0968504 | Ga0451791_0968504_317_529 | 69 |
| 107 | 3300041456 | Ga0451795_1322993 | Ga0451795_1322993_265_474 | 69 |
| 108 | 3300041486 | Ga0451807_1297969 | Ga0451807_1297969_71_283 | 69 |
| 109 | 3300041486 | Ga0451807_1457053 | Ga0451807_1457053_222_437 | 69 |
| 110 | 3300041512 | Ga0451853_0620789 | Ga0451853_0620789_161_373 | 69 |
| 111 | 3300041997 | Ga0439431_0049632 | Ga0439431_0049632_91_300 | 69 |
| 112 | 3300041997 | Ga0439431_0102997 | Ga0439431_0102997_190_402 | 69 |
| 113 | 3300042002 | Ga0439442_048066 | Ga0439442_048066_551_760 | 69 |
| 114 | 3300042007 | Ga0439449_0208938 | Ga0439449_0208938_462_671 | 69 |
| 115 | 3300042014 | Ga0439457_062394 | Ga0439457_062394_299_508 | 69 |
| 116 | 3300042131 | Ga0450894_026638 | Ga0450894_026638_302_511 | 69 |
| 117 | 3300042135 | Ga0450899_006418 | Ga0450899_006418_867_1076 | 69 |
| 118 | 3300042435 | Ga0439434_0013029 | Ga0439434_0013029_1839_2048 | 69 |
| 119 | 3300044683 | Ga0466965_0209264 | Ga0466965_0209264_798_1010 | 69 |
| 120 | 3300046519 | Ga0495632_0471630 | Ga0495632_0471630_110_322 | 69 |
| 121 | 3300046522 | Ga0495643_0130642 | Ga0495643_0130642_204_413 | 69 |
| 122 | 3300046542 | Ga0495597_0345115 | Ga0495597_0345115_189_401 | 69 |
| 123 | 3300046660 | Ga0495625_0127184 | Ga0495625_0127184_50_259 | 69 |
| 124 | 3300047472 | Ga0495686_0016014 | Ga0495686_0016014_3003_3221 | 69 |
| 125 | 3300047472 | Ga0495686_0040374 | Ga0495686_0040374_2707_2925 | 69 |
| 126 | 3300049523 | Ga0501300_001636 | Ga0501300_001636_294_506 | 69 |
| 127 | 3300049571 | Ga0501034_0032051 | Ga0501034_0032051_4035_4292 | 69 |
| 128 | 3300049571 | Ga0501034_0618984 | Ga0501034_0618984_546_803 | 69 |
| 129 | 3300049571 | Ga0501034_1596677 | Ga0501034_1596677_273_485 | 69 |
| 130 | 3300049572 | Ga0501036_0666453 | Ga0501036_0666453_147_404 | 69 |
| 131 | 3300049573 | Ga0501037_0010051 | Ga0501037_0010051_4802_5059 | 69 |
| 132 | 3300049575 | Ga0501039_0460986 | Ga0501039_0460986_78_335 | 69 |
| 133 | 3300049579 | Ga0501043_0021306 | Ga0501043_0021306_2652_2909 | 69 |
| 134 | 3300049579 | Ga0501043_0062675 | Ga0501043_0062675_2298_2555 | 69 |
| 135 | 3300049581 | Ga0501047_0062425 | Ga0501047_0062425_1722_1979 | 69 |
| 136 | 3300049581 | Ga0501047_0693762 | Ga0501047_0693762_267_524 | 69 |
| 137 | 3300049581 | Ga0501047_0908431 | Ga0501047_0908431_39_296 | 69 |
| 138 | 3300049582 | Ga0501048_0158975 | Ga0501048_0158975_65_322 | 69 |
| 139 | 3300049652 | Ga0501202_002985 | Ga0501202_002985_2426_2638 | 69 |
| 140 | 3300049657 | Ga0501210_015878 | Ga0501210_015878_431_643 | 69 |
| 141 | 3300049661 | Ga0501217_002986 | Ga0501217_002986_2823_3035 | 69 |
| 142 | 3300049670 | Ga0501236_000147 | Ga0501236_000147_2381_2593 | 69 |
| 143 | 3300049677 | Ga0501247_002266 | Ga0501247_002266_100_312 | 69 |
| 144 | 3300049686 | Ga0501257_033142 | Ga0501257_033142_984_1196 | 69 |
| 145 | 3300049690 | Ga0501261_095016 | Ga0501261_095016_312_527 | 69 |
| 146 | 3300049742 | Ga0501080_1316606 | Ga0501080_1316606_48_305 | 69 |
| 147 | 3300049761 | Ga0501264_000007 | Ga0501264_000007_27000_27212 | 69 |
| 148 | 3300049768 | Ga0501271_010854 | Ga0501271_010854_384_596 | 69 |
| 149 | 3300049822 | Ga0501035_0115187 | Ga0501035_0115187_1740_1997 | 69 |
| 150 | 3300049823 | Ga0501044_0018114 | Ga0501044_0018114_4877_5134 | 69 |
| 151 | 3300050493 | nmdc:mga0k408_260290_c1 | nmdc:mga0k408_260290_c1_782_1000 | 69 |
| 152 | 3300050493 | nmdc:mga0k408_66927_c1 | nmdc:mga0k408_66927_c1_820_1032 | 69 |
| 153 | 3300050511 | nmdc:mga08y16_12569_c1 | nmdc:mga08y16_12569_c1_2612_2830 | 69 |
| 154 | 3300050511 | nmdc:mga08y16_1269666_c1 | nmdc:mga08y16_1269666_c1_474_692 | 69 |
| 155 | 3300053086 | Ga0500578_0553468 | Ga0500578_0553468_79_291 | 69 |
| 156 | 3300053088 | Ga0500644_0035621 | Ga0500644_0035621_415_627 | 69 |
| 157 | 3300053098 | Ga0500650_0478938 | Ga0500650_0478938_104_316 | 69 |
| 158 | 3300053100 | Ga0500660_126468 | Ga0500660_126468_330_539 | 69 |
| 159 | 3300053109 | Ga0500569_044715 | Ga0500569_044715_930_1139 | 69 |
| 160 | 3300053121 | Ga0500607_046087 | Ga0500607_046087_860_1069 | 69 |
| 161 | 3300053131 | Ga0500652_106383 | Ga0500652_106383_615_827 | 69 |
| 162 | 3300053133 | Ga0500655_009793 | Ga0500655_009793_663_875 | 69 |
| 163 | 3300053134 | Ga0500658_0128985 | Ga0500658_0128985_638_847 | 69 |
| 164 | 3300053137 | Ga0500561_0169322 | Ga0500561_0169322_177_389 | 69 |
| 165 | 3300053142 | Ga0500577_0006065 | Ga0500577_0006065_1830_2039 | 69 |
| 166 | 3300053153 | Ga0500616_0000024 | Ga0500616_0000024_320739_320951 | 69 |
| 167 | 3300053153 | Ga0500616_0025323 | Ga0500616_0025323_198_410 | 69 |
| 168 | 3300053156 | Ga0500622_0093339 | Ga0500622_0093339_598_810 | 69 |
| 169 | 3300053160 | Ga0500633_0045585 | Ga0500633_0045585_934_1182 | 69 |
| 170 | 3300053730 | Ga0500645_170843 | Ga0500645_170843_226_438 | 69 |
| 171 | 3300059645 | Ga0587076_075338 | Ga0587076_075338_17_232 | 69 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vd7-assembly1.cif.gz_A | cryo-em structure of xenopus tropicalis pannexin 1 channel | 0.5454 | 5 | 65 |
| 7wsv-assembly1.cif.gz_A | cryo-em structure of the n-terminal deletion mutant of human pannexin-1 in a nanodisc | 0.5146 | 5 | 63 |
| 8dxp-assembly1.cif.gz_D | structure of lrrc8c-lrrc8a(il125) chimera, class 3 | 0.4972 | 5 | 64 |
| 6vd7-assembly1.cif.gz_A | cryo-em structure of xenopus tropicalis pannexin 1 channel | 0.4967 | 5 | 65 |
| 1sfx-assembly1.cif.gz_A | x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus | 0.488 | 11 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A6M3QAV0_1_161_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6576 | 2 | 63 | 1.20.140.150 |
| af_P23482_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.602 | 5 | 68 | 1.20.1070.10 |
| af_P16429_1_123_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5911 | 5 | 65 | 1.20.1070.10 |
| af_Q9VTT1_11_110_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5386 | 2 | 68 | 1.10.287.370 |
| af_F1LV86_1_179_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5317 | 2 | 68 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M5T2S7-F1-model_v4 | LPXTG-motif cell wall anchor domain-containing protein | 0.8955 | 2 | 67 |
GO:0016020
|
| AF-A0A5C7RPT8-F1-model_v4 | DUF3185 domain-containing protein | 0.8941 | 2 | 65 |
GO:0016020
|
| AF-A0A4R3MYZ7-F1-model_v4 | Secreted protein with PEP-CTERM sorting signal | 0.8845 | 2 | 64 |
GO:0016020
|
| AF-D3RSD1-F1-model_v4 | Uncharacterized protein | 0.864 | 2 | 63 |
GO:0016020
|
| AF-A0A1M5T2S7-F1-model_v4 | LPXTG-motif cell wall anchor domain-containing protein | 0.849 | 2 | 67 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar