F258405

General Info

Members Datasets Scaffolds Average Seq Length
171 118 342 309

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100295958|Ga0068864_1002959581
Length 357
Sequence MYVFVLIVNAFSIKNYFSTNAAPAQFSFLKNGYCKWLLYEVKQGYLNMKAIILSEFGPAQNLQLADVGVPEINDGQVLVKVNAIGINPVDVKSRETQAVLTGIKDRPIILGWDISGIVTESNSPQFKKGDEVFGMVNFPGHGKAYAEFVAAPAAHLALKPVNTSHDEAAAACLAALTAWQILTEHYKLSKGQRVLIHAGSGGVGHYAVQIAKYLGAYVIATSSAANKRFVLSLGADEHIDYQAVQFEDEADNIDLVINPLTREIAERSIAVVKQGGTVISIASGVDDELKEKAGKKNVKIFKTMVKSSGKDMQQLAKLLYDGQFESHVSEVFALEDIRKAHASIESGRTVGKIVVKP

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
84 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
91 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
92 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
93 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
94 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
95 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
96 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
97 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
98 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
99 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
100 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
101 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
102 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
103 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
104 2738541284 Pedobacter sp. YR016 Isolate Unclassified
105 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
106 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
107 2818991444 Filimonas endophytica 3197 Isolate Unclassified
108 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
109 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
110 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
111 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
112 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
113 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
114 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
115 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
116 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
117 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
118 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.29
Metatranscriptomes 0
Isolates 18.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.32
Nodule 0
Rhizoplane 0.58
Rhizosphere 52.63
Stem 0
Stem Tuber 0
Unclassified 8.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100295958 3300005618 Unclassified 1514
2 SwRhRL2b_contig_2963908 2162886007 Bacteria 27528
3 SwRhRL2b_contig_848163 2162886007 Bacteria 8408
4 JGI24739J22299_10003818 3300001989 Bacteria 5751
5 JGI25162J39368_1000094 3300002737 Bacteria 98697
6 JGI25152J39213_1000119 3300002773 Bacteria 55075
7 JGI25150J39212_1000015 3300002774 Bacteria 170613
8 JGI25151J46595_10000043 3300003187 Bacteria 170613
9 JGI25153J46596_10000009 3300003215 Bacteria 340925
10 JGI25153J46596_10014940 3300003215 Bacteria 3193
11 rootH2_10021597 3300003320 Bacteria 13452
12 rootH2_10074946 3300003320 Bacteria 19018
13 rootH2_10111492 3300003320 Bacteria 8789
14 rootH2_10264285 3300003320 Bacteria 1473
15 rootL2_10012667 3300003322 Unclassified 2313
16 rootL2_10062650 3300003322 Bacteria 3153
17 rootL2_10113605 3300003322 Bacteria 5189
18 rootH1_10011669 3300003323 Bacteria 39831
19 rootH1_10029642 3300003323 Bacteria 6330
20 rootH1_10044203 3300003323 Bacteria 16551
21 rootH1_10237648 3300003323 Bacteria 5563
22 rootH1_10268403 3300003323 Bacteria 1415
23 JGI25160J50197_1000828 3300003354 Bacteria 16518
24 Ga0055526_1008301 3300003771 Bacteria 5208
25 Ga0055526_1015553 3300003771 Unclassified 3048
26 Ga0055528_1000654 3300003790 Bacteria 25156
27 Ga0055530_10001559 3300003791 Bacteria 16450
28 Ga0055531_10000003 3300003794 Bacteria 274424
29 Ga0055543_1002943 3300004625 Bacteria 5305
30 Ga0065165_1000514 3300005262 Bacteria 59489
31 Ga0065165_1001277 3300005262 Bacteria 28455
32 Ga0065165_1007470 3300005262 Bacteria 5359
33 Ga0065714_10002572 3300005288 Bacteria 21257
34 Ga0065714_10003280 3300005288 Bacteria 26984
35 Ga0065714_10007344 3300005288 Bacteria 4281
36 Ga0065704_10070251 3300005289 Bacteria 48366
37 Ga0065704_10070284 3300005289 Bacteria 39613
38 Ga0070670_100072798 3300005331 Bacteria 2951
39 Ga0070689_100017536 3300005340 Bacteria 5261
40 Ga0070669_100037466 3300005353 Bacteria 3518
41 Ga0070662_100011718 3300005457 Bacteria 5788
42 Ga0070665_100000093 3300005548 Bacteria 173153
43 Ga0068857_100006847 3300005577 Bacteria 9810
44 Ga0068854_100528525 3300005578 Unclassified 997
45 Ga0068852_100178873 3300005616 Unclassified 1993
46 Ga0068858_100083583 3300005842 Unclassified 2969
47 Ga0081455_10014148 3300005937 Bacteria 7839
48 Ga0105240_10000328 3300009093 Bacteria 89466
49 Ga0105240_10355268 3300009093 Bacteria 1661
50 Ga0105237_10001170 3300009545 Bacteria 35066
51 Ga0105237_10022847 3300009545 Bacteria 6415
52 Ga0105237_10024298 3300009545 Bacteria 6201
53 Ga0105249_10121726 3300009553 Bacteria 2480
54 Ga0105239_10000718 3300010375 Bacteria 47004
55 Ga0105239_10025315 3300010375 Bacteria 6534
56 Ga0157373_10000601 3300013100 Bacteria 27966
57 Ga0157373_10093647 3300013100 Unclassified 2116
58 Ga0157371_10000486 3300013102 Bacteria 48340
59 Ga0157371_10071813 3300013102 Bacteria 2450
60 Ga0157370_10000315 3300013104 Bacteria 60631
61 Ga0157370_10001591 3300013104 Bacteria 28044
62 Ga0157370_10017747 3300013104 Bacteria 7173
63 Ga0157370_10022458 3300013104 Bacteria 6277
64 Ga0157370_10030991 3300013104 Bacteria 5236
65 Ga0157369_10370062 3300013105 Unclassified 1488
66 Ga0163162_10028661 3300013306 Bacteria 5511
67 Ga0163162_10333748 3300013306 Bacteria 1649
68 Ga0157372_10181658 3300013307 Bacteria 2435
69 Ga0157372_10188397 3300013307 Bacteria 2389
70 Ga0157375_10256624 3300013308 Bacteria 1910
71 Ga0182008_10000014 3300014497 Bacteria 263844
72 Ga0182005_1000067 3300015265 Bacteria 87767
73 Ga0183373_1001 3300015682 Bacteria 1410374
74 Ga0163161_10009484 3300017792 Bacteria 6737
75 Ga0209436_101035 3300025208 Bacteria 10651
76 Ga0209436_102653 3300025208 Bacteria 5203
77 Ga0209437_100077 3300025233 Bacteria 286656
78 Ga0207425_1000023 3300025245 Bacteria 341339
79 Ga0209129_1000032 3300025258 Bacteria 341150
80 Ga0209233_1019759 3300025261 Bacteria 1783
81 Ga0209673_1000014 3300025273 Bacteria 537082
82 Ga0209673_1000018 3300025273 Bacteria 458281
83 Ga0209130_1002535 3300025284 Bacteria 8951
84 Ga0209676_1000370 3300025292 Bacteria 83303
85 Ga0209025_1000047 3300025294 Bacteria 341150
86 Ga0209564_1000812 3300025295 Bacteria 42671
87 Ga0209564_1002001 3300025295 Bacteria 17818
88 Ga0209758_1000144 3300025297 Bacteria 170724
89 Ga0209758_1003177 3300025297 Bacteria 15395
90 Ga0209758_1010838 3300025297 Bacteria 5383
91 Ga0209050_1000750 3300025298 Bacteria 46636
92 Ga0207426_1000073 3300025302 Bacteria 323756
93 Ga0207426_1000096 3300025302 Bacteria 271627
94 Ga0207426_1000612 3300025302 Bacteria 46054
95 Ga0207426_1008362 3300025302 Bacteria 4192
96 Ga0207426_1009000 3300025302 Bacteria 3977
97 Ga0207426_1050429 3300025302 Unclassified 1241
98 Ga0209257_1000008 3300025304 Bacteria 1294570
99 Ga0209257_1006230 3300025304 Bacteria 7818
100 Ga0207695_10002144 3300025913 Bacteria 29897
101 Ga0207671_10004574 3300025914 Bacteria 13145
102 Ga0207671_10009755 3300025914 Bacteria 7992
103 Ga0207671_10017817 3300025914 Bacteria 5464
104 Ga0207681_10057630 3300025923 Bacteria 2656
105 Ga0207709_10000176 3300025935 Bacteria 86175
106 Ga0207703_10084801 3300026035 Unclassified 2650
107 Ga0207674_10024148 3300026116 Bacteria 6500
108 Ga0207698_10254255 3300026142 Unclassified 1610
109 Ga0268266_10000060 3300028379 Bacteria 269063
110 Ga0307405_10032638 3300031731 Unclassified 3079
111 Ga0307412_10000043 3300031911 Bacteria 166562
112 Ga0307414_10157597 3300032004 Unclassified 1799
113 Ga0395900_0127620 3300037418 Unclassified 2608
114 Ga0439431_0016362 3300041997 Bacteria 1735
115 Ga0439442_006408 3300042002 Bacteria 2362
116 Ga0439457_020727 3300042014 Bacteria 1458
117 Ga0450897_004382 3300042128 Bacteria 1179
118 Ga0466969_0047685 3300044656 Bacteria 2120
119 Ga0453684_0464680 3300044712 Bacteria 1406
120 Ga0495616_0019737 3300046513 Bacteria 3676
121 Ga0495643_0000941 3300046522 Bacteria 30163
122 Ga0495622_0019873 3300046557 Bacteria 3126
123 Ga0495686_0007000 3300047472 Bacteria 8521
124 Ga0496115_0301431 3300048918 Bacteria 1313
125 Ga0496116_0000642 3300048919 Bacteria 45587
126 Ga0496121_0000051 3300048924 Bacteria 315378
127 Ga0496122_0000090 3300048925 Bacteria 205886
128 Ga0496122_0000294 3300048925 Bacteria 110530
129 Ga0496123_0001908 3300048926 Bacteria 27193
130 Ga0496125_0000072 3300048928 Bacteria 238328
131 Ga0496125_0064173 3300048928 Bacteria 2921
132 Ga0496126_0005725 3300048929 Bacteria 14072
133 Ga0496126_0075059 3300048929 Bacteria 3001
134 Ga0501033_0236908 3300049570 Bacteria 1295
135 Ga0501217_013615 3300049661 Unclassified 1827
136 Ga0500651_0006546 3300053093 Bacteria 6725
137 Ga0500618_002726 3300053125 Bacteria 6440
138 Ga0500618_003576 3300053125 Bacteria 5281
139 Ga0500622_0000123 3300053156 Bacteria 81320
140 2511233411 2511231000 Bacteria 4488346
141 2522553105 2522125168 Bacteria 7376607
142 2585157535 2582581281 Bacteria 4487904
143 2585161933 2582581282 Bacteria 4495830
144 2587679510 2585428045 Bacteria 5203023
145 2587747878 2585428060 Bacteria 5304711
146 2588446431 2588253712 Bacteria 5403181
147 2590601106 2588254255 Bacteria 5014294
148 2590611526 2588254257 Bacteria 5436094
149 2738700016 2738541273 Bacteria 4048577
150 2738764221 2738541284 Bacteria 5199923
151 2739253765 2738543014 Bacteria 4048139
152 2819577110 2818991442 Bacteria 8318214
153 2819587305 2818991444 Bacteria 6968812
154 2819587684 2818991444 Bacteria 6968812
155 2819678087 2818991460 Bacteria 7595395
156 2821140398 2821136567 Bacteria 8080116
157 2881248298 2881247448 Bacteria 3717788
158 2881249367 2881247448 Bacteria 3717788
159 2884792753 2884791551 Bacteria 8511252
160 2884792931 2884791551 Bacteria 8511252
161 2884797414 2884791551 Bacteria 8511252
162 2904472816 2904467357 Bacteria 8057758
163 2904784620 2904780799 Bacteria 5840761
164 2919181173 2919177583 Bacteria 5641607
165 2929181208 2929177148 Bacteria 7883697
166 2929182551 2929177148 Bacteria 7883697
167 2945978475 2945977869 Bacteria 7777518
168 2945983610 2945977869 Bacteria 7777518
169 2946015662 2946013367 Bacteria 7766675
170 2946017002 2946013367 Bacteria 7766675
171 2965320630 2965320100 Bacteria 3975600
172 Ga0068864_100295958
173 SwRhRL2b_contig_2963908
174 SwRhRL2b_contig_848163
175 JGI24739J22299_10003818
176 JGI25162J39368_1000094
177 JGI25152J39213_1000119
178 JGI25150J39212_1000015
179 JGI25151J46595_10000043
180 JGI25153J46596_10000009
181 JGI25153J46596_10014940
182 rootH2_10021597
183 rootH2_10074946
184 rootH2_10111492
185 rootH2_10264285
186 rootL2_10012667
187 rootL2_10062650
188 rootL2_10113605
189 rootH1_10011669
190 rootH1_10029642
191 rootH1_10044203
192 rootH1_10237648
193 rootH1_10268403
194 JGI25160J50197_1000828
195 Ga0055526_1008301
196 Ga0055526_1015553
197 Ga0055528_1000654
198 Ga0055530_10001559
199 Ga0055531_10000003
200 Ga0055543_1002943
201 Ga0065165_1000514
202 Ga0065165_1001277
203 Ga0065165_1007470
204 Ga0065714_10002572
205 Ga0065714_10003280
206 Ga0065714_10007344
207 Ga0065704_10070251
208 Ga0065704_10070284
209 Ga0070670_100072798
210 Ga0070689_100017536
211 Ga0070669_100037466
212 Ga0070662_100011718
213 Ga0070665_100000093
214 Ga0068857_100006847
215 Ga0068854_100528525
216 Ga0068852_100178873
217 Ga0068858_100083583
218 Ga0081455_10014148
219 Ga0105240_10000328
220 Ga0105240_10355268
221 Ga0105237_10001170
222 Ga0105237_10022847
223 Ga0105237_10024298
224 Ga0105249_10121726
225 Ga0105239_10000718
226 Ga0105239_10025315
227 Ga0157373_10000601
228 Ga0157373_10093647
229 Ga0157371_10000486
230 Ga0157371_10071813
231 Ga0157370_10000315
232 Ga0157370_10001591
233 Ga0157370_10017747
234 Ga0157370_10022458
235 Ga0157370_10030991
236 Ga0157369_10370062
237 Ga0163162_10028661
238 Ga0163162_10333748
239 Ga0157372_10181658
240 Ga0157372_10188397
241 Ga0157375_10256624
242 Ga0182008_10000014
243 Ga0182005_1000067
244 Ga0183373_1001
245 Ga0163161_10009484
246 Ga0209436_101035
247 Ga0209436_102653
248 Ga0209437_100077
249 Ga0207425_1000023
250 Ga0209129_1000032
251 Ga0209233_1019759
252 Ga0209673_1000014
253 Ga0209673_1000018
254 Ga0209130_1002535
255 Ga0209676_1000370
256 Ga0209025_1000047
257 Ga0209564_1000812
258 Ga0209564_1002001
259 Ga0209758_1000144
260 Ga0209758_1003177
261 Ga0209758_1010838
262 Ga0209050_1000750
263 Ga0207426_1000073
264 Ga0207426_1000096
265 Ga0207426_1000612
266 Ga0207426_1008362
267 Ga0207426_1009000
268 Ga0207426_1050429
269 Ga0209257_1000008
270 Ga0209257_1006230
271 Ga0207695_10002144
272 Ga0207671_10004574
273 Ga0207671_10009755
274 Ga0207671_10017817
275 Ga0207681_10057630
276 Ga0207709_10000176
277 Ga0207703_10084801
278 Ga0207674_10024148
279 Ga0207698_10254255
280 Ga0268266_10000060
281 Ga0307405_10032638
282 Ga0307412_10000043
283 Ga0307414_10157597
284 Ga0395900_0127620
285 Ga0439431_0016362
286 Ga0439442_006408
287 Ga0439457_020727
288 Ga0450897_004382
289 Ga0466969_0047685
290 Ga0453684_0464680
291 Ga0495616_0019737
292 Ga0495643_0000941
293 Ga0495622_0019873
294 Ga0495686_0007000
295 Ga0496115_0301431
296 Ga0496116_0000642
297 Ga0496121_0000051
298 Ga0496122_0000090
299 Ga0496122_0000294
300 Ga0496123_0001908
301 Ga0496125_0000072
302 Ga0496125_0064173
303 Ga0496126_0005725
304 Ga0496126_0075059
305 Ga0501033_0236908
306 Ga0501217_013615
307 Ga0500651_0006546
308 Ga0500618_002726
309 Ga0500618_003576
310 Ga0500622_0000123
311 2511233411
312 2522553105
313 2585157535
314 2585161933
315 2587679510
316 2587747878
317 2588446431
318 2590601106
319 2590611526
320 2738700016
321 2738764221
322 2739253765
323 2819577110
324 2819587305
325 2819587684
326 2819678087
327 2821140398
328 2881248298
329 2881249367
330 2884792753
331 2884792931
332 2884797414
333 2904472816
334 2904784620
335 2919181173
336 2929181208
337 2929182551
338 2945978475
339 2945983610
340 2946015662
341 2946017002
342 2965320630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

233

355

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

73

161

0.85

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

202

321

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9481 5 307
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9332 5 307
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9311 5 307
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.9206 2 307
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9166 5 307
ID Description Score Start End Superfamily
3tqhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9529 125 256 3.40.50.720
3tqhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9391 125 256 3.40.50.720
af_I1LV40_37_360_3.30.70.80 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 0.9265 5 303 3.30.70.80
af_Q924D0_50_393_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9218 4 304 3.90.180.10
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9176 123 217 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A1T4U2H3-F1-model_v4 NADPH:quinone reductase 0.992 2 307 GO:0008270
GO:0016491
AF-A0A1T4U2H3-F1-model_v4 NADPH:quinone reductase 0.9824 2 307 GO:0008270
GO:0016491
AF-A0A066U2D4-F1-model_v4 NADPH:quinone reductase 0.9782 5 307 GO:0008270
GO:0016491
AF-A0A2N6D7M1-F1-model_v4 NADP-dependent oxidoreductase 0.9701 2 307 GO:0003723
GO:0008270
GO:0016491
AF-A0A418YKQ8-F1-model_v4 NADP-dependent oxidoreductase 0.9656 2 306 GO:0008270
GO:0016491

Map