F258462

General Info

Members Datasets Scaffolds Average Seq Length
171 115 342 303

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10009451|Ga0070717_100094515
Length 338
Sequence MVRSMNEAALNTTRPAAVGLRPSALCSPAMAELDLDDLAVFVRVIEHGGFASAARQLGEPTSTVSRAIARLEARSGVRLLHRTTRSVRPTSEGHELYASIAPAVSTLRSAAQALEPSTRKPKGRVRVTAPNDLCASFLPEVIVAFLERYPLVNLDFTVTNQHSNLVGEGFDVALRAAARLSDSTLVARKLGELELRLYASPKYAKKYGLPATPDELHQHKCIVFRAEELVRTWALAGTQGDANLQIRGRIGGDDFSFVRAIVGAGGGIGILPHINSAADEASGRLVRVLPDYHLRGATLYLLYPSSRNLPTRVTAFRDFVIEAFDAWSARRDRGPSVG

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
19 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
31 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
37 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
40 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
41 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
42 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
45 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
46 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
47 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
48 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
49 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
50 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
51 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
52 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
53 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
54 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
55 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
56 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
57 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
58 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
59 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
66 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
67 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
72 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
73 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
74 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
75 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
81 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
98 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
99 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
100 2738541280 Massilia sp. GV090 Isolate Unclassified
101 2738541297 Duganella sp. GV083 Isolate Unclassified
102 2738541357 Duganella sp. GV053 Isolate Unclassified
103 2738543003 Duganella sp. GV066 Isolate Unclassified
104 2738543026 Duganella sp. GV089 Isolate Unclassified
105 2738543029 Duganella sp. GV039 Isolate Unclassified
106 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
107 2821131069 Duganella sp. 1224 Isolate Unclassified
108 2842711865 Duganella sp. R-73148 Isolate Unclassified
109 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
110 2857558681 Duganella sp. R-74565 Isolate Unclassified
111 2857564685 Duganella sp. R-74599 Isolate Unclassified
112 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
113 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
114 2904424332 Duganella sp. 1411 Isolate Rhizosphere
115 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0
Isolates 9.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 1.17
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10009451 3300006028 Bacteria 7328
2 JGI25153J46596_10026437 3300003215 Bacteria 2053
3 rootH2_10276245 3300003320 Unclassified 1994
4 rootH1_10041030 3300003323 Bacteria 7982
5 rootH1_10262070 3300003323 Bacteria 2974
6 Ga0070658_10075321 3300005327 Bacteria 2768
7 Ga0070680_100076861 3300005336 Bacteria 2749
8 Ga0070682_100011264 3300005337 Bacteria 5104
9 Ga0070714_100149709 3300005435 Bacteria 2102
10 Ga0068867_100105958 3300005459 Bacteria 2153
11 Ga0068855_100008812 3300005563 Bacteria 12194
12 Ga0068856_100218035 3300005614 Bacteria 1923
13 Ga0068862_100012604 3300005844 Bacteria 6998
14 Ga0070717_10134439 3300006028 Bacteria 2128
15 Ga0075366_10008963 3300006195 Bacteria 5578
16 Ga0105244_10002319 3300009036 Bacteria 14472
17 Ga0105244_10003935 3300009036 Bacteria 10426
18 Ga0105240_10004485 3300009093 Bacteria 21237
19 Ga0105243_10073415 3300009148 Bacteria 2772
20 Ga0105238_10199485 3300009551 Bacteria 1976
21 Ga0213872_10018696 3300021361 Bacteria 3194
22 Ga0209025_1013688 3300025294 Bacteria 5071
23 Ga0209564_1000009 3300025295 Bacteria 950196
24 Ga0209758_1000689 3300025297 Bacteria 50075
25 Ga0207655_1002357 3300025728 Bacteria 15426
26 Ga0207655_1004706 3300025728 Bacteria 9549
27 Ga0207695_10023115 3300025913 Bacteria 7035
28 Ga0207660_10034023 3300025917 Bacteria 3529
29 Ga0207694_10269567 3300025924 Bacteria 1396
30 Ga0207709_10034208 3300025935 Bacteria 2993
31 Ga0207702_10085950 3300026078 Bacteria 2742
32 Ga0209371_1004336 3300027312 Bacteria 6245
33 Ga0268265_10033096 3300028380 Bacteria 3755
34 Ga0268256_1006078 3300030500 Bacteria 4567
35 Ga0316181_1007093 3300030744 Bacteria 5128
36 Ga0316181_1182478 3300030744 Bacteria 5461
37 Ga0307513_10317033 3300031456 Bacteria 1319
38 Ga0307509_10000330 3300031507 Bacteria 78146
39 Ga0307516_10001021 3300031730 Bacteria 38830
40 Ga0307412_10000129 3300031911 Bacteria 55318
41 Ga0307412_10323674 3300031911 Bacteria 1228
42 Ga0307507_10136023 3300033179 Bacteria 1903
43 Ga0373961_0000008 3300035241 Bacteria 139095
44 Ga0395905_0000063 3300037471 Bacteria 187830
45 Ga0436361_0453993 3300039447 Bacteria 3723
46 Ga0451577_0447319 3300042876 Bacteria 1173
47 Ga0495617_000025 3300046452 Bacteria 164547
48 Ga0495617_000330 3300046452 Bacteria 26567
49 Ga0495590_0000014 3300046457 Bacteria 258314
50 Ga0495638_0000064 3300046460 Bacteria 180807
51 Ga0495638_0010959 3300046460 Bacteria 6270
52 Ga0495638_0043815 3300046460 Bacteria 2821
53 Ga0495638_0148275 3300046460 Bacteria 1363
54 Ga0495638_0222515 3300046460 Bacteria 1054
55 Ga0495653_0000016 3300046463 Bacteria 200976
56 Ga0495650_0000141 3300046471 Bacteria 168676
57 Ga0495650_0000255 3300046471 Bacteria 103396
58 Ga0495650_0000992 3300046471 Bacteria 32292
59 Ga0495650_0001991 3300046471 Bacteria 17939
60 Ga0495639_0010811 3300046475 Bacteria 3930
61 Ga0495584_0001774 3300046491 Bacteria 12561
62 Ga0495585_0000798 3300046492 Bacteria 27541
63 Ga0495607_0009737 3300046501 Bacteria 6487
64 Ga0495583_0000044 3300046506 Bacteria 226264
65 Ga0495606_0000037 3300046507 Bacteria 231282
66 Ga0495606_0000051 3300046507 Bacteria 201659
67 Ga0495606_0000319 3300046507 Bacteria 82626
68 Ga0495606_0000480 3300046507 Bacteria 65473
69 Ga0495606_0002074 3300046507 Bacteria 24489
70 Ga0495610_0000027 3300046512 Bacteria 275273
71 Ga0495610_0003802 3300046512 Bacteria 11507
72 Ga0495610_0006322 3300046512 Bacteria 8195
73 Ga0495610_0026022 3300046512 Bacteria 3130
74 Ga0495610_0039313 3300046512 Bacteria 2393
75 Ga0495637_0000193 3300046520 Bacteria 47867
76 Ga0495637_0001031 3300046520 Bacteria 17468
77 Ga0495643_0000184 3300046522 Bacteria 100035
78 Ga0495643_0000365 3300046522 Bacteria 61592
79 Ga0495648_0000006 3300046524 Bacteria 361208
80 Ga0495648_0003068 3300046524 Bacteria 14916
81 Ga0495648_0003461 3300046524 Bacteria 13885
82 Ga0495648_0008970 3300046524 Bacteria 7812
83 Ga0495648_0062907 3300046524 Bacteria 2195
84 Ga0495642_0000388 3300046528 Bacteria 23790
85 Ga0495654_0000022 3300046530 Bacteria 260104
86 Ga0495654_0003064 3300046530 Bacteria 10406
87 Ga0495609_0007817 3300046538 Bacteria 5294
88 Ga0495597_0000120 3300046542 Bacteria 70808
89 Ga0495597_0001113 3300046542 Bacteria 20346
90 Ga0495622_0000013 3300046557 Bacteria 186778
91 Ga0495633_0000430 3300046558 Bacteria 43655
92 Ga0495633_0002546 3300046558 Bacteria 12792
93 Ga0495633_0009472 3300046558 Bacteria 5375
94 Ga0495656_0109202 3300046615 Bacteria 1291
95 Ga0495668_0000232 3300046616 Bacteria 79391
96 Ga0495668_0000506 3300046616 Bacteria 48675
97 Ga0495668_0000599 3300046616 Bacteria 43861
98 Ga0495625_0000394 3300046660 Bacteria 66655
99 Ga0495625_0000455 3300046660 Bacteria 61315
100 Ga0495625_0005419 3300046660 Bacteria 11647
101 Ga0495659_0000079 3300046664 Bacteria 41571
102 Ga0495661_0032374 3300046665 Bacteria 3305
103 Ga0495671_0000064 3300046692 Bacteria 106374
104 Ga0495671_0000535 3300046692 Bacteria 28720
105 Ga0495671_0011593 3300046692 Bacteria 4844
106 Ga0495671_0018175 3300046692 Bacteria 3733
107 Ga0495649_0010643 3300046694 Bacteria 5417
108 Ga0495649_0011313 3300046694 Bacteria 5239
109 Ga0495649_0022342 3300046694 Bacteria 3540
110 Ga0495649_0092863 3300046694 Bacteria 1607
111 Ga0495660_0002858 3300046810 Bacteria 10852
112 Ga0495660_0005093 3300046810 Bacteria 7895
113 Ga0495672_0000075 3300047320 Bacteria 175957
114 Ga0495672_0000262 3300047320 Bacteria 73028
115 Ga0495683_0007571 3300047323 Bacteria 5856
116 Ga0495687_002482 3300047443 Bacteria 14712
117 Ga0495677_0017817 3300047445 Bacteria 2574
118 Ga0495677_0018104 3300047445 Bacteria 2553
119 Ga0495679_017589 3300047446 Bacteria 2556
120 Ga0495673_0000008 3300047469 Bacteria 752462
121 Ga0495673_0000009 3300047469 Bacteria 731993
122 Ga0495673_0000012 3300047469 Bacteria 656908
123 Ga0495673_0014423 3300047469 Bacteria 4109
124 Ga0495686_0006458 3300047472 Bacteria 8971
125 Ga0495686_0024133 3300047472 Bacteria 3999
126 Ga0495686_0035485 3300047472 Bacteria 3205
127 Ga0495615_0002196 3300048090 Bacteria 3086
128 Ga0496103_0002358 3300048906 Bacteria 11915
129 Ga0496115_0103454 3300048918 Bacteria 2336
130 Ga0496117_0020912 3300048920 Bacteria 5321
131 Ga0496118_0033344 3300048921 Bacteria 4226
132 Ga0496119_0067412 3300048922 Bacteria 2110
133 Ga0496121_0000137 3300048924 Bacteria 164043
134 Ga0496121_0018847 3300048924 Bacteria 6927
135 Ga0496122_0027829 3300048925 Bacteria 4820
136 Ga0496122_0048168 3300048925 Bacteria 3281
137 Ga0496123_0017355 3300048926 Bacteria 5795
138 Ga0496123_0021745 3300048926 Bacteria 4973
139 Ga0496124_0138183 3300048927 Bacteria 1926
140 Ga0496125_0000023 3300048928 Bacteria 449042
141 Ga0496125_0036987 3300048928 Bacteria 4251
142 Ga0496126_0096401 3300048929 Bacteria 2593
143 Ga0495678_000114 3300049459 Bacteria 96823
144 Ga0495678_007856 3300049459 Bacteria 5479
145 Ga0501047_0039604 3300049581 Bacteria 4558
146 Ga0501080_0358596 3300049742 Bacteria 1316
147 Ga0501269_000064 3300049766 Bacteria 33135
148 Ga0501269_000301 3300049766 Bacteria 13446
149 nmdc:mga0k408_30710_c1 3300050493 Bacteria 3065
150 Ga0500635_0006608 3300053080 Bacteria 3103
151 Ga0500618_000168 3300053125 Bacteria 54749
152 Ga0500568_0008965 3300053139 Bacteria 4782
153 Ga0500586_000726 3300053145 Bacteria 6761
154 Ga0500630_073264 3300053159 Bacteria 1616
155 Ga0500639_153534 3300053163 Unclassified 1058
156 2738741799 2738541280 Bacteria 6630198
157 2738826535 2738541297 Bacteria 6549566
158 2739150332 2738541357 Bacteria 6549408
159 2739192251 2738543003 Bacteria 6549560
160 2739318728 2738543026 Bacteria 6549408
161 2739336969 2738543029 Bacteria 6549249
162 2739351280 2738543031 Bacteria 5769731
163 2821135251 2821131069 Bacteria 6108407
164 2842718145 2842711865 Bacteria 7155354
165 2857539917 2857537821 Bacteria 5248181
166 2857559084 2857558681 Bacteria 6617694
167 2857567728 2857564685 Bacteria 6290584
168 2889792085 2889790730 Bacteria 5689708
169 2889919243 2889914905 Bacteria 5702301
170 2904428017 2904424332 Bacteria 7633521
171 2941479885
172 Ga0070717_10009451
173 JGI25153J46596_10026437
174 rootH2_10276245
175 rootH1_10041030
176 rootH1_10262070
177 Ga0070658_10075321
178 Ga0070680_100076861
179 Ga0070682_100011264
180 Ga0070714_100149709
181 Ga0068867_100105958
182 Ga0068855_100008812
183 Ga0068856_100218035
184 Ga0068862_100012604
185 Ga0070717_10134439
186 Ga0075366_10008963
187 Ga0105244_10002319
188 Ga0105244_10003935
189 Ga0105240_10004485
190 Ga0105243_10073415
191 Ga0105238_10199485
192 Ga0213872_10018696
193 Ga0209025_1013688
194 Ga0209564_1000009
195 Ga0209758_1000689
196 Ga0207655_1002357
197 Ga0207655_1004706
198 Ga0207695_10023115
199 Ga0207660_10034023
200 Ga0207694_10269567
201 Ga0207709_10034208
202 Ga0207702_10085950
203 Ga0209371_1004336
204 Ga0268265_10033096
205 Ga0268256_1006078
206 Ga0316181_1007093
207 Ga0316181_1182478
208 Ga0307513_10317033
209 Ga0307509_10000330
210 Ga0307516_10001021
211 Ga0307412_10000129
212 Ga0307412_10323674
213 Ga0307507_10136023
214 Ga0373961_0000008
215 Ga0395905_0000063
216 Ga0436361_0453993
217 Ga0451577_0447319
218 Ga0495617_000025
219 Ga0495617_000330
220 Ga0495590_0000014
221 Ga0495638_0000064
222 Ga0495638_0010959
223 Ga0495638_0043815
224 Ga0495638_0148275
225 Ga0495638_0222515
226 Ga0495653_0000016
227 Ga0495650_0000141
228 Ga0495650_0000255
229 Ga0495650_0000992
230 Ga0495650_0001991
231 Ga0495639_0010811
232 Ga0495584_0001774
233 Ga0495585_0000798
234 Ga0495607_0009737
235 Ga0495583_0000044
236 Ga0495606_0000037
237 Ga0495606_0000051
238 Ga0495606_0000319
239 Ga0495606_0000480
240 Ga0495606_0002074
241 Ga0495610_0000027
242 Ga0495610_0003802
243 Ga0495610_0006322
244 Ga0495610_0026022
245 Ga0495610_0039313
246 Ga0495637_0000193
247 Ga0495637_0001031
248 Ga0495643_0000184
249 Ga0495643_0000365
250 Ga0495648_0000006
251 Ga0495648_0003068
252 Ga0495648_0003461
253 Ga0495648_0008970
254 Ga0495648_0062907
255 Ga0495642_0000388
256 Ga0495654_0000022
257 Ga0495654_0003064
258 Ga0495609_0007817
259 Ga0495597_0000120
260 Ga0495597_0001113
261 Ga0495622_0000013
262 Ga0495633_0000430
263 Ga0495633_0002546
264 Ga0495633_0009472
265 Ga0495656_0109202
266 Ga0495668_0000232
267 Ga0495668_0000506
268 Ga0495668_0000599
269 Ga0495625_0000394
270 Ga0495625_0000455
271 Ga0495625_0005419
272 Ga0495659_0000079
273 Ga0495661_0032374
274 Ga0495671_0000064
275 Ga0495671_0000535
276 Ga0495671_0011593
277 Ga0495671_0018175
278 Ga0495649_0010643
279 Ga0495649_0011313
280 Ga0495649_0022342
281 Ga0495649_0092863
282 Ga0495660_0002858
283 Ga0495660_0005093
284 Ga0495672_0000075
285 Ga0495672_0000262
286 Ga0495683_0007571
287 Ga0495687_002482
288 Ga0495677_0017817
289 Ga0495677_0018104
290 Ga0495679_017589
291 Ga0495673_0000008
292 Ga0495673_0000009
293 Ga0495673_0000012
294 Ga0495673_0014423
295 Ga0495686_0006458
296 Ga0495686_0024133
297 Ga0495686_0035485
298 Ga0495615_0002196
299 Ga0496103_0002358
300 Ga0496115_0103454
301 Ga0496117_0020912
302 Ga0496118_0033344
303 Ga0496119_0067412
304 Ga0496121_0000137
305 Ga0496121_0018847
306 Ga0496122_0027829
307 Ga0496122_0048168
308 Ga0496123_0017355
309 Ga0496123_0021745
310 Ga0496124_0138183
311 Ga0496125_0000023
312 Ga0496125_0036987
313 Ga0496126_0096401
314 Ga0495678_000114
315 Ga0495678_007856
316 Ga0501047_0039604
317 Ga0501080_0358596
318 Ga0501269_000064
319 Ga0501269_000301
320 nmdc:mga0k408_30710_c1
321 Ga0500635_0006608
322 Ga0500618_000168
323 Ga0500568_0008965
324 Ga0500586_000726
325 Ga0500630_073264
326 Ga0500639_153534
327 2738741799
328 2738826535
329 2739150332
330 2739192251
331 2739318728
332 2739336969
333 2739351280
334 2821135251
335 2842718145
336 2857539917
337 2857559084
338 2857567728
339 2889792085
340 2889919243
341 2904428017
342 2941479885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

35

94

0.98

PF03466

LysR_substrate

LysR substrate binding domain

118

325

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9632 4 83
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9609 4 83
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9535 4 80
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9505 4 83
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9462 4 83
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9904 6 83 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9839 4 79 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9798 4 84 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 4 80 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 6 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9211 109 295 GO:0003700
GO:0006351
GO:0043565
AF-H1S4I0-F1-model_v4 HTH-type transcriptional activator TtdR 0.9072 47 297
AF-A0A447T6W0-F1-model_v4 D-malate degradation protein R 0.9056 87 297 GO:0003700
GO:0006351
GO:0043565
AF-J2H940-F1-model_v4 Transcriptional regulator 0.8934 155 295
AF-A0A2G2NJW5-F1-model_v4 LysR family transcriptional regulator 0.8792 1 298 GO:0003700

Map