F258500

General Info

Members Datasets Scaffolds Average Seq Length
171 94 163 89

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10889906|Ga0075364_108899062
Length 106
Sequence MPRDGIETGTPRGSKRMKIVAICGAGIGTSGILKVNAERVLSRLGIEATVVATDLGSLAAEAEDAQVILTGPEFLDAIGTTSADVIVVENYFDTEELSEKLHRALG

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
3 2643221649 Leifsonia sp. Root4 Isolate Unclassified
4 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
5 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
6 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
7 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
8 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
42 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
43 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
44 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
45 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
46 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
47 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
50 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
51 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
52 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
53 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
54 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
55 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
56 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
57 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
58 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
59 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
60 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
61 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
62 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
63 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
85 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
86 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
87 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
88 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
89 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
92 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
93 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.56
Nodule 0
Rhizoplane 4.68
Rhizosphere 48.54
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000044 3300005327 Bacteria 131465
2 Ga0070670_100625852 3300005331 Bacteria 964
3 Ga0070659_100103144 3300005366 Bacteria 2297
4 Ga0070714_100278616 3300005435 Bacteria 1553
5 Ga0070710_10075728 3300005437 Bacteria 1951
6 Ga0070711_100472660 3300005439 Bacteria 1029
7 Ga0070663_100090352 3300005455 Bacteria 2268
8 Ga0070679_102015758 3300005530 Bacteria 526
9 Ga0068853_100228050 3300005539 Bacteria 1703
10 Ga0068855_100017781 3300005563 Bacteria 8547
11 Ga0068859_101491974 3300005617 Bacteria 746
12 Ga0075365_11301278 3300006038 Bacteria 511
13 Ga0075363_100271124 3300006048 Bacteria 980
14 Ga0075364_10516234 3300006051 Bacteria 817
15 Ga0075364_10889906 3300006051 Bacteria 606
16 Ga0097620_101491837 3300006931 Bacteria 746
17 Ga0105244_10155059 3300009036 Bacteria 1096
18 Ga0157371_10006757 3300013102 Bacteria 9378
19 Ga0157370_10026224 3300013104 Bacteria 5757
20 Ga0157370_10486678 3300013104 Bacteria 1134
21 Ga0157380_11802277 3300014326 Bacteria 671
22 Ga0207692_10070031 3300025898 Bacteria 1845
23 Ga0207647_10031645 3300025904 Bacteria 3403
24 Ga0207705_10000001 3300025909 Bacteria 2061880
25 Ga0207705_10334572 3300025909 Bacteria 1165
26 Ga0207644_10143008 3300025931 Bacteria 1844
27 Ga0207690_10006488 3300025932 Bacteria 6936
28 Ga0207667_12076799 3300025949 Bacteria 527
29 Ga0207639_10369642 3300026041 Bacteria 1285
30 Ga0207678_10046327 3300026067 Bacteria 3760
31 Ga0307515_10348101 3300028794 Bacteria 1130
32 Ga0307515_10550962 3300028794 Bacteria 763
33 Ga0307513_10181207 3300031456 Bacteria 1969
34 Ga0307513_10456811 3300031456 Bacteria 1001
35 Ga0307514_10001437 3300031649 Bacteria 29185
36 Ga0307514_10137704 3300031649 Bacteria 1667
37 Ga0307416_102528245 3300032002 Bacteria 612
38 Ga0395898_0211081 3300037466 Bacteria 1852
39 Ga0395905_1413014 3300037471 Bacteria 600
40 Ga0451787_355492 3300041441 Bacteria 1416
41 Ga0451787_492338 3300041441 Bacteria 898
42 Ga0451793_0276229 3300041452 Bacteria 1313
43 Ga0451793_0839398 3300041452 Bacteria 711
44 Ga0451793_1866605 3300041452 Bacteria 1288
45 Ga0451804_0193218 3300041463 Bacteria 747
46 Ga0451807_1415744 3300041486 Bacteria 535
47 Ga0451843_1408282 3300041509 Bacteria 616
48 Ga0439462_0048505 3300042015 Bacteria 1139
49 Ga0466965_0000008 3300044683 Bacteria 131465
50 Ga0495590_0000227 3300046457 Bacteria 30807
51 Ga0495650_0002733 3300046471 Bacteria 13667
52 Ga0495654_0422659 3300046530 Bacteria 527
53 Ga0495656_0021302 3300046615 Bacteria 2522
54 Ga0495672_0344622 3300047320 Bacteria 693
55 Ga0495686_0019615 3300047472 Bacteria 4518
56 Ga0496115_1225901 3300048918 Bacteria 562
57 Ga0496116_0006886 3300048919 Bacteria 10204
58 Ga0496116_0017795 3300048919 Bacteria 5502
59 Ga0496117_0000275 3300048920 Bacteria 95947
60 Ga0496118_0090432 3300048921 Bacteria 2109
61 Ga0496118_0619930 3300048921 Bacteria 514
62 Ga0496119_0000034 3300048922 Bacteria 218417
63 Ga0496119_0010225 3300048922 Bacteria 7917
64 Ga0496119_0128671 3300048922 Bacteria 1382
65 Ga0496119_0371605 3300048922 Bacteria 688
66 Ga0496120_0000026 3300048923 Bacteria 235131
67 Ga0496120_0000360 3300048923 Bacteria 74606
68 Ga0496120_0009772 3300048923 Bacteria 6766
69 Ga0496120_0023397 3300048923 Bacteria 3868
70 Ga0496120_0279026 3300048923 Bacteria 773
71 Ga0496121_0117489 3300048924 Bacteria 2015
72 Ga0496122_0000008 3300048925 Bacteria 596403
73 Ga0496122_0000512 3300048925 Bacteria 80116
74 Ga0496122_0001012 3300048925 Bacteria 49765
75 Ga0496122_0003322 3300048925 Bacteria 21251
76 Ga0496123_0000053 3300048926 Bacteria 234794
77 Ga0496123_0003548 3300048926 Bacteria 17317
78 Ga0496123_0003556 3300048926 Bacteria 17292
79 Ga0496125_0000045 3300048928 Bacteria 296312
80 Ga0496126_0000021 3300048929 Bacteria 472971
81 Ga0496126_0000618 3300048929 Bacteria 66848
82 Ga0496126_0187189 3300048929 Bacteria 1755
83 Ga0501031_0617027 3300049568 Bacteria 697
84 Ga0501032_0034114 3300049569 Bacteria 3484
85 Ga0501033_0012201 3300049570 Bacteria 6559
86 Ga0501033_0024386 3300049570 Bacteria 4562
87 Ga0501033_0391900 3300049570 Bacteria 969
88 Ga0501034_0012787 3300049571 Bacteria 8657
89 Ga0501034_0023396 3300049571 Bacteria 6296
90 Ga0501034_0042751 3300049571 Bacteria 4587
91 Ga0501034_0092683 3300049571 Bacteria 3017
92 Ga0501034_0290052 3300049571 Bacteria 1574
93 Ga0501034_0297935 3300049571 Bacteria 1550
94 Ga0501034_0301383 3300049571 Bacteria 1539
95 Ga0501034_0318852 3300049571 Bacteria 1487
96 Ga0501034_0746623 3300049571 Bacteria 874
97 Ga0501034_0835866 3300049571 Bacteria 812
98 Ga0501036_0246951 3300049572 Bacteria 1496
99 Ga0501036_0430928 3300049572 Bacteria 1099
100 Ga0501036_0485431 3300049572 Bacteria 1028
101 Ga0501036_0840622 3300049572 Unclassified 755
102 Ga0501037_0247047 3300049573 Bacteria 1249
103 Ga0501037_0636024 3300049573 Bacteria 714
104 Ga0501038_0006347 3300049574 Bacteria 10942
105 Ga0501038_0231991 3300049574 Bacteria 1468
106 Ga0501038_0251640 3300049574 Bacteria 1399
107 Ga0501038_0272739 3300049574 Bacteria 1333
108 Ga0501039_0146375 3300049575 Bacteria 1856
109 Ga0501043_0343510 3300049579 Bacteria 1135
110 Ga0501047_0736642 3300049581 Bacteria 802
111 Ga0501047_1349843 3300049581 Bacteria 527
112 Ga0501067_0481726 3300049583 Bacteria 694
113 Ga0501068_0819345 3300049584 Bacteria 611
114 Ga0501068_1056115 3300049584 Bacteria 537
115 Ga0501070_0920848 3300049586 Bacteria 681
116 Ga0501072_0011233 3300049588 Bacteria 6838
117 Ga0501072_0479428 3300049588 Bacteria 984
118 Ga0501073_0107034 3300049589 Bacteria 1940
119 Ga0501073_0697526 3300049589 Bacteria 700
120 Ga0501035_0065890 3300049822 Bacteria 3215
121 Ga0501035_0583563 3300049822 Bacteria 913
122 Ga0501035_0678661 3300049822 Bacteria 833
123 Ga0501044_0290614 3300049823 Bacteria 1566
124 Ga0501044_0642806 3300049823 Bacteria 950
125 Ga0501044_0972491 3300049823 Bacteria 721
126 nmdc:mga0yw44_418033_c1 3300050492 Bacteria 907
127 nmdc:mga06z11_1013381_c1 3300050494 Bacteria 506
128 Ga0500635_0000004 3300053080 Bacteria 210675
129 Ga0500635_0331319 3300053080 Bacteria 602
130 Ga0500650_0019134 3300053098 Bacteria 2983
131 Ga0500554_135990 3300053102 Bacteria 831
132 Ga0500556_0000001 3300053104 Bacteria 1135060
133 Ga0500556_0103242 3300053104 Bacteria 1100
134 Ga0500559_0000210 3300053136 Bacteria 46871
135 Ga0500559_0002172 3300053136 Bacteria 10372
136 Ga0500559_0039887 3300053136 Bacteria 2043
137 Ga0500559_0157850 3300053136 Bacteria 1065
138 Ga0500559_0200972 3300053136 Bacteria 940
139 Ga0500559_0201702 3300053136 Bacteria 938
140 Ga0500568_0000003 3300053139 Bacteria 863587
141 Ga0500568_0000414 3300053139 Bacteria 32584
142 Ga0500568_0003353 3300053139 Bacteria 8970
143 Ga0500568_0011097 3300053139 Bacteria 4197
144 Ga0500573_0000001 3300053140 Bacteria 436394
145 Ga0500573_0004060 3300053140 Bacteria 7659
146 Ga0500573_0015237 3300053140 Bacteria 4356
147 Ga0500573_0034675 3300053140 Bacteria 2911
148 Ga0500573_0062560 3300053140 Bacteria 2130
149 Ga0500573_0073561 3300053140 Bacteria 1947
150 Ga0500573_0098482 3300053140 Bacteria 1647
151 Ga0500573_0175697 3300053140 Bacteria 1155
152 Ga0500573_0189507 3300053140 Bacteria 1099
153 Ga0500573_0214102 3300053140 Bacteria 1015
154 Ga0500573_0307173 3300053140 Bacteria 790
155 Ga0500573_0362655 3300053140 Bacteria 699
156 Ga0500573_0398880 3300053140 Bacteria 652
157 Ga0500573_0471628 3300053140 Unclassified 574
158 Ga0500577_0016374 3300053142 Bacteria 2336
159 Ga0500577_0040397 3300053142 Bacteria 1696
160 Ga0500577_0154826 3300053142 Bacteria 973
161 Ga0500577_0544428 3300053142 Bacteria 506
162 Ga0500588_0008704 3300053146 Bacteria 2383
163 Ga0500616_0000109 3300053153 Bacteria 152604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0000275 Ga0496117_0000275_75928_76203 72
2 3300048921 Ga0496118_0090432 Ga0496118_0090432_505_780 72
3 3300048922 Ga0496119_0000034 Ga0496119_0000034_202988_203263 72
4 3300048922 Ga0496119_0010225 Ga0496119_0010225_6221_6496 72
5 3300048922 Ga0496119_0128671 Ga0496119_0128671_325_600 72
6 3300048923 Ga0496120_0000026 Ga0496120_0000026_227468_227743 72
7 3300048923 Ga0496120_0000360 Ga0496120_0000360_58107_58382 72
8 3300048923 Ga0496120_0009772 Ga0496120_0009772_1364_1639 72
9 3300048923 Ga0496120_0023397 Ga0496120_0023397_3300_3575 72
10 3300048925 Ga0496122_0000512 Ga0496122_0000512_2155_2430 72
11 3300048926 Ga0496123_0000053 Ga0496123_0000053_49317_49592 72
12 3300048928 Ga0496125_0000045 Ga0496125_0000045_206272_206547 72
13 3300048929 Ga0496126_0000618 Ga0496126_0000618_19733_20008 72
14 3300048919 Ga0496116_0006886 Ga0496116_0006886_5617_5892 81
15 3300048919 Ga0496116_0017795 Ga0496116_0017795_4032_4307 81
16 3300048922 Ga0496119_0371605 Ga0496119_0371605_267_542 81
17 3300048923 Ga0496120_0279026 Ga0496120_0279026_313_588 81
18 iso_pu_bacteria 2870622029 2870624655 85
19 iso_pu_bacteria 2585428094 2587863814 86
20 iso_pu_bacteria 2643221635 2644197117 86
21 iso_pu_bacteria 2643221649 2644277625 86
22 iso_pu_bacteria 2852643534 2852646329 86
23 iso_pu_bacteria 2857733635 2857736021 86
24 iso_pu_bacteria 2857737099 2857737564 86
25 iso_pu_bacteria 2966924647 2966926432 86
26 3300048925 Ga0496122_0000008 Ga0496122_0000008_347468_347746 88
27 3300048926 Ga0496123_0003548 Ga0496123_0003548_13233_13511 88
28 3300048929 Ga0496126_0000021 Ga0496126_0000021_246411_246689 88
29 3300053098 Ga0500650_0019134 Ga0500650_0019134_114_383 89
30 3300053140 Ga0500573_0004060 Ga0500573_0004060_3328_3600 89
31 3300053140 Ga0500573_0073561 Ga0500573_0073561_633_905 89
32 3300053142 Ga0500577_0016374 Ga0500577_0016374_629_901 89
33 3300053142 Ga0500577_0040397 Ga0500577_0040397_150_419 89
34 3300053142 Ga0500577_0154826 Ga0500577_0154826_250_519 89
35 3300005327 Ga0070658_10000044 Ga0070658_1000004471 90
36 3300005331 Ga0070670_100625852 Ga0070670_1006258521 90
37 3300005366 Ga0070659_100103144 Ga0070659_1001031442 90
38 3300005435 Ga0070714_100278616 Ga0070714_1002786163 90
39 3300005437 Ga0070710_10075728 Ga0070710_100757282 90
40 3300005439 Ga0070711_100472660 Ga0070711_1004726602 90
41 3300005455 Ga0070663_100090352 Ga0070663_1000903523 90
42 3300005530 Ga0070679_102015758 Ga0070679_1020157582 90
43 3300005539 Ga0068853_100228050 Ga0068853_1002280503 90
44 3300005563 Ga0068855_100017781 Ga0068855_1000177818 90
45 3300005617 Ga0068859_101491974 Ga0068859_1014919742 90
46 3300006038 Ga0075365_11301278 Ga0075365_113012782 90
47 3300006048 Ga0075363_100271124 Ga0075363_1002711242 90
48 3300006051 Ga0075364_10516234 Ga0075364_105162342 90
49 3300006051 Ga0075364_10889906 Ga0075364_108899062 90
50 3300006931 Ga0097620_101491837 Ga0097620_1014918372 90
51 3300009036 Ga0105244_10155059 Ga0105244_101550592 90
52 3300013102 Ga0157371_10006757 Ga0157371_100067577 90
53 3300013104 Ga0157370_10026224 Ga0157370_100262243 90
54 3300013104 Ga0157370_10486678 Ga0157370_104866782 90
55 3300014326 Ga0157380_11802277 Ga0157380_118022772 90
56 3300025898 Ga0207692_10070031 Ga0207692_100700313 90
57 3300025904 Ga0207647_10031645 Ga0207647_100316455 90
58 3300025909 Ga0207705_10000001 Ga0207705_100000011522 90
59 3300025909 Ga0207705_10334572 Ga0207705_103345721 90
60 3300025931 Ga0207644_10143008 Ga0207644_101430081 90
61 3300025932 Ga0207690_10006488 Ga0207690_100064885 90
62 3300025949 Ga0207667_12076799 Ga0207667_120767991 90
63 3300026041 Ga0207639_10369642 Ga0207639_103696423 90
64 3300026067 Ga0207678_10046327 Ga0207678_100463274 90
65 3300028794 Ga0307515_10348101 Ga0307515_103481013 90
66 3300028794 Ga0307515_10550962 Ga0307515_105509622 90
67 3300031456 Ga0307513_10181207 Ga0307513_101812072 90
68 3300031456 Ga0307513_10456811 Ga0307513_104568112 90
69 3300031649 Ga0307514_10001437 Ga0307514_1000143711 90
70 3300031649 Ga0307514_10137704 Ga0307514_101377043 90
71 3300032002 Ga0307416_102528245 Ga0307416_1025282451 90
72 3300037466 Ga0395898_0211081 Ga0395898_0211081_583_855 90
73 3300037471 Ga0395905_1413014 Ga0395905_1413014_126_398 90
74 3300041441 Ga0451787_355492 Ga0451787_355492_185_460 90
75 3300041441 Ga0451787_492338 Ga0451787_492338_198_473 90
76 3300041452 Ga0451793_0276229 Ga0451793_0276229_888_1160 90
77 3300041452 Ga0451793_0839398 Ga0451793_0839398_300_572 90
78 3300041452 Ga0451793_1866605 Ga0451793_1866605_848_1120 90
79 3300041463 Ga0451804_0193218 Ga0451804_0193218_189_461 90
80 3300041486 Ga0451807_1415744 Ga0451807_1415744_131_406 90
81 3300041509 Ga0451843_1408282 Ga0451843_1408282_126_404 90
82 3300042015 Ga0439462_0048505 Ga0439462_0048505_540_812 90
83 3300044683 Ga0466965_0000008 Ga0466965_0000008_93775_94047 90
84 3300046457 Ga0495590_0000227 Ga0495590_0000227_15022_15294 90
85 3300046471 Ga0495650_0002733 Ga0495650_0002733_1208_1480 90
86 3300046530 Ga0495654_0422659 Ga0495654_0422659_159_479 90
87 3300046615 Ga0495656_0021302 Ga0495656_0021302_1650_1925 90
88 3300047320 Ga0495672_0344622 Ga0495672_0344622_354_626 90
89 3300047472 Ga0495686_0019615 Ga0495686_0019615_2388_2660 90
90 3300048918 Ga0496115_1225901 Ga0496115_1225901_104_376 90
91 3300048921 Ga0496118_0619930 Ga0496118_0619930_28_300 90
92 3300048924 Ga0496121_0117489 Ga0496121_0117489_187_459 90
93 3300048925 Ga0496122_0001012 Ga0496122_0001012_41107_41379 90
94 3300048925 Ga0496122_0003322 Ga0496122_0003322_16630_16902 90
95 3300048926 Ga0496123_0003556 Ga0496123_0003556_12880_13152 90
96 3300048929 Ga0496126_0187189 Ga0496126_0187189_1110_1382 90
97 3300049568 Ga0501031_0617027 Ga0501031_0617027_264_536 90
98 3300049569 Ga0501032_0034114 Ga0501032_0034114_1659_1931 90
99 3300049570 Ga0501033_0012201 Ga0501033_0012201_1765_2037 90
100 3300049570 Ga0501033_0024386 Ga0501033_0024386_3233_3505 90
101 3300049570 Ga0501033_0391900 Ga0501033_0391900_406_678 90
102 3300049571 Ga0501034_0012787 Ga0501034_0012787_2916_3188 90
103 3300049571 Ga0501034_0023396 Ga0501034_0023396_578_850 90
104 3300049571 Ga0501034_0042751 Ga0501034_0042751_2299_2571 90
105 3300049571 Ga0501034_0092683 Ga0501034_0092683_2076_2348 90
106 3300049571 Ga0501034_0290052 Ga0501034_0290052_1273_1545 90
107 3300049571 Ga0501034_0297935 Ga0501034_0297935_908_1180 90
108 3300049571 Ga0501034_0301383 Ga0501034_0301383_876_1148 90
109 3300049571 Ga0501034_0318852 Ga0501034_0318852_943_1224 90
110 3300049571 Ga0501034_0746623 Ga0501034_0746623_33_323 90
111 3300049571 Ga0501034_0835866 Ga0501034_0835866_422_694 90
112 3300049572 Ga0501036_0246951 Ga0501036_0246951_825_1097 90
113 3300049572 Ga0501036_0430928 Ga0501036_0430928_494_766 90
114 3300049572 Ga0501036_0485431 Ga0501036_0485431_19_291 90
115 3300049572 Ga0501036_0840622 Ga0501036_0840622_110_382 90
116 3300049573 Ga0501037_0247047 Ga0501037_0247047_28_300 90
117 3300049573 Ga0501037_0636024 Ga0501037_0636024_324_596 90
118 3300049574 Ga0501038_0006347 Ga0501038_0006347_67_339 90
119 3300049574 Ga0501038_0231991 Ga0501038_0231991_66_338 90
120 3300049574 Ga0501038_0251640 Ga0501038_0251640_440_712 90
121 3300049574 Ga0501038_0272739 Ga0501038_0272739_900_1172 90
122 3300049575 Ga0501039_0146375 Ga0501039_0146375_303_575 90
123 3300049579 Ga0501043_0343510 Ga0501043_0343510_717_989 90
124 3300049581 Ga0501047_0736642 Ga0501047_0736642_418_690 90
125 3300049581 Ga0501047_1349843 Ga0501047_1349843_236_508 90
126 3300049583 Ga0501067_0481726 Ga0501067_0481726_164_436 90
127 3300049584 Ga0501068_0819345 Ga0501068_0819345_280_561 90
128 3300049584 Ga0501068_1056115 Ga0501068_1056115_166_438 90
129 3300049586 Ga0501070_0920848 Ga0501070_0920848_198_470 90
130 3300049588 Ga0501072_0011233 Ga0501072_0011233_4206_4487 90
131 3300049588 Ga0501072_0479428 Ga0501072_0479428_396_668 90
132 3300049589 Ga0501073_0107034 Ga0501073_0107034_500_781 90
133 3300049589 Ga0501073_0697526 Ga0501073_0697526_75_347 90
134 3300049822 Ga0501035_0065890 Ga0501035_0065890_2840_3112 90
135 3300049822 Ga0501035_0583563 Ga0501035_0583563_397_669 90
136 3300049822 Ga0501035_0678661 Ga0501035_0678661_395_667 90
137 3300049823 Ga0501044_0290614 Ga0501044_0290614_942_1214 90
138 3300049823 Ga0501044_0642806 Ga0501044_0642806_23_295 90
139 3300049823 Ga0501044_0972491 Ga0501044_0972491_434_706 90
140 3300050492 nmdc:mga0yw44_418033_c1 nmdc:mga0yw44_418033_c1_239_514 90
141 3300050494 nmdc:mga06z11_1013381_c1 nmdc:mga06z11_1013381_c1_152_427 90
142 3300053080 Ga0500635_0000004 Ga0500635_0000004_73594_73866 90
143 3300053080 Ga0500635_0331319 Ga0500635_0331319_290_562 90
144 3300053102 Ga0500554_135990 Ga0500554_135990_364_636 90
145 3300053104 Ga0500556_0000001 Ga0500556_0000001_1071032_1071304 90
146 3300053104 Ga0500556_0103242 Ga0500556_0103242_88_378 90
147 3300053136 Ga0500559_0000210 Ga0500559_0000210_25626_25898 90
148 3300053136 Ga0500559_0002172 Ga0500559_0002172_8624_8911 90
149 3300053136 Ga0500559_0039887 Ga0500559_0039887_1578_1865 90
150 3300053136 Ga0500559_0157850 Ga0500559_0157850_561_833 90
151 3300053136 Ga0500559_0200972 Ga0500559_0200972_289_561 90
152 3300053136 Ga0500559_0201702 Ga0500559_0201702_433_705 90
153 3300053139 Ga0500568_0000003 Ga0500568_0000003_554706_554978 90
154 3300053139 Ga0500568_0000414 Ga0500568_0000414_22559_22831 90
155 3300053139 Ga0500568_0003353 Ga0500568_0003353_7624_7896 90
156 3300053139 Ga0500568_0011097 Ga0500568_0011097_1967_2272 90
157 3300053140 Ga0500573_0000001 Ga0500573_0000001_39210_39482 90
158 3300053140 Ga0500573_0015237 Ga0500573_0015237_3040_3312 90
159 3300053140 Ga0500573_0034675 Ga0500573_0034675_474_746 90
160 3300053140 Ga0500573_0062560 Ga0500573_0062560_252_524 90
161 3300053140 Ga0500573_0098482 Ga0500573_0098482_747_1019 90
162 3300053140 Ga0500573_0175697 Ga0500573_0175697_474_746 90
163 3300053140 Ga0500573_0189507 Ga0500573_0189507_233_505 90
164 3300053140 Ga0500573_0214102 Ga0500573_0214102_21_293 90
165 3300053140 Ga0500573_0307173 Ga0500573_0307173_94_366 90
166 3300053140 Ga0500573_0362655 Ga0500573_0362655_192_464 90
167 3300053140 Ga0500573_0398880 Ga0500573_0398880_286_558 90
168 3300053140 Ga0500573_0471628 Ga0500573_0471628_47_319 90
169 3300053142 Ga0500577_0544428 Ga0500577_0544428_35_307 90
170 3300053146 Ga0500588_0008704 Ga0500588_0008704_398_670 90
171 3300053153 Ga0500616_0000109 Ga0500616_0000109_31329_31601 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02302

PTS_IIB

PTS system, Lactose/Cellobiose specific IIB subunit

18

103

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3czc-assembly1.cif.gz_A the crystal structure of a putative pts iib(ptxb) from streptococcus mutans 0.8396 1 90
3czc-assembly1.cif.gz_A the crystal structure of a putative pts iib(ptxb) from streptococcus mutans 0.8316 1 90
1vrv-assembly1.cif.gz_A structure of phosphorylated iib (c384(sep)) domain of the mannitol-specific permease enzyme ii 0.7982 2 88
1vkr-assembly1.cif.gz_A structure of iib domain of the mannitol-specific permease enzyme ii 0.7975 2 88
1vrv-assembly1.cif.gz_A structure of phosphorylated iib (c384(sep)) domain of the mannitol-specific permease enzyme ii 0.768 2 88
ID Description Score Start End Superfamily
af_P69822_2_93_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8907 1 90 3.40.50.2300
af_P69822_2_93_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8817 1 90 3.40.50.2300
af_Q2G144_1_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8809 1 90 3.40.50.2300
af_Q2G144_1_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8718 1 90 3.40.50.2300
3czcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8126 1 90 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3A1TSJ7-F1-model_v4 PTS sugar transporter subunit IIB 0.9873 1 90 GO:0008982
GO:0009401
AF-A0A1T4Z1D8-F1-model_v4 PTS system IIB component, L-Asc family 0.9757 1 88 GO:0008982
GO:0009401
AF-A0A7M2C363-F1-model_v4 PTS sugar transporter subunit IIB 0.9738 1 90 GO:0008982
GO:0009401
AF-A0A6A8MX40-F1-model_v4 deleted 0.9645 1 90
AF-A0A512HXN2-F1-model_v4 PTS ascorbate transporter subunit IIB 0.9558 1 90 GO:0008982
GO:0009401

Feature Viewer

pLDDT pTM Quality
91.07 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map