F259135

General Info

Members Datasets Scaffolds Average Seq Length
171 118 143 395

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0008931|Ga0395899_0008931_5278_6546
Length 422
Sequence MTSRASSRLDLVLQLAVVALVGLNLRPFITGVGPLAADLSAQSGLGLQGMAMLTLVPMLLMGCFAFAGPFLQARVGARRAVIVALAVLGLASFLRLFVSTGAQIVATAALLGFGAAIVQAVFPGIVKQQFPRHVGMVMGLYSAMLMGGGAVGAQASPIVADLFGNWRAGLAWMAVPALAAMILAACYLRRDGVGRQGGTSAVSFLRRPRTWLLMACFGLVNGGYSTVVAWLAPSYQEHGWTGAASGSLLAIMALCQAVAALLLPTLARGSNDLRPWLWLTLAMQAAGFAGLALWPEAAPIVWAILLGAGLGGCFALSMIVALDHLPDPTQAGALSALMQGGGFLIAAIPPWIIAVLHDITGSFLAGWVLHLICIAVVTVLYWRVDPRGYEQAMTPSSPEHDGDKVGGNGVGSDRLMRSEVAI

Samples

Sample ID Description Type Environment
1 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
2 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
3 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
4 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
5 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
6 2643221618 Ensifer sp. Root231 Isolate Unclassified
7 2643221626 Ensifer sp. Root31 Isolate Unclassified
8 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
9 2643221655 Ensifer sp. Root1252 Isolate Unclassified
10 2643221659 Ensifer sp. Root127 Isolate Unclassified
11 2643221698 Ensifer sp. Root142 Isolate Unclassified
12 2643221712 Ensifer sp. Root258 Isolate Unclassified
13 2643221718 Rhizobium sp. Root268 Isolate Unclassified
14 2643221723 Ensifer sp. Root278 Isolate Unclassified
15 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
16 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
17 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
18 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
19 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
20 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
21 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
22 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
23 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
24 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
25 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
26 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
27 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
48 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
49 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
117 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
118 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.63
Metatranscriptomes 0
Isolates 16.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 3.51
Rhizoplane 0.58
Rhizosphere 69.59
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000111 3300002737 Bacteria 89317
2 JGI25159J45721_1000024 3300002987 Bacteria 116245
3 JGI25165J46597_1000070 3300003214 Bacteria 193557
4 JGI25160J50197_1000063 3300003354 Bacteria 116245
5 Ga0055526_1000541 3300003771 Bacteria 29823
6 Ga0055526_1005378 3300003771 Bacteria 7377
7 Ga0055524_1000011 3300003775 Bacteria 261442
8 Ga0058692_1000010 3300003856 Bacteria 326761
9 Ga0055543_1000124 3300004625 Bacteria 63936
10 Ga0065165_1000163 3300005262 Bacteria 116283
11 Ga0070663_100013889 3300005455 Bacteria 5152
12 Ga0068857_100050481 3300005577 Bacteria 3690
13 Ga0068854_100028644 3300005578 Bacteria 3851
14 Ga0105244_10009492 3300009036 Bacteria 5978
15 Ga0105250_10008840 3300009092 Bacteria 4262
16 Ga0105240_10000739 3300009093 Bacteria 59740
17 Ga0105240_10120343 3300009093 Bacteria 3162
18 Ga0105240_10122001 3300009093 Bacteria 3137
19 Ga0105241_10029641 3300009174 Bacteria 4085
20 Ga0105237_10002121 3300009545 Bacteria 25037
21 Ga0105237_10021656 3300009545 Bacteria 6608
22 Ga0105238_10032329 3300009551 Bacteria 5323
23 Ga0105238_10061034 3300009551 Bacteria 3774
24 Ga0105239_10000454 3300010375 Bacteria 59740
25 Ga0157373_10018501 3300013100 Bacteria 5072
26 Ga0157371_10017730 3300013102 Bacteria 5283
27 Ga0171463_1005 3300013249 Bacteria 358236
28 Ga0183363_1090 3300015690 Bacteria 27043
29 Ga0209760_100795 3300025207 Bacteria 4333
30 Ga0209436_102817 3300025208 Bacteria 4941
31 Ga0209672_101702 3300025228 Bacteria 7089
32 Ga0207427_106353 3300025231 Bacteria 1508
33 Ga0209437_100064 3300025233 Bacteria 334360
34 Ga0209233_1000081 3300025261 Bacteria 336832
35 Ga0209233_1000131 3300025261 Bacteria 205257
36 Ga0209455_1003321 3300025272 Bacteria 5763
37 Ga0209130_1000138 3300025284 Bacteria 116297
38 Ga0209675_1000596 3300025291 Bacteria 25925
39 Ga0209025_1001231 3300025294 Bacteria 35703
40 Ga0209564_1000250 3300025295 Bacteria 114790
41 Ga0209564_1000369 3300025295 Bacteria 83878
42 Ga0209256_1000317 3300025299 Bacteria 83179
43 Ga0207426_1000255 3300025302 Bacteria 116297
44 Ga0209257_1011682 3300025304 Bacteria 4187
45 Ga0207696_1007558 3300025711 Bacteria 4240
46 Ga0207655_1014101 3300025728 Bacteria 4539
47 Ga0207695_10000788 3300025913 Bacteria 59670
48 Ga0207671_10000411 3300025914 Bacteria 59718
49 Ga0207671_10044338 3300025914 Bacteria 3289
50 Ga0207694_10019258 3300025924 Bacteria 5159
51 Ga0207640_10009624 3300025981 Bacteria 5419
52 Ga0207678_10045408 3300026067 Bacteria 3799
53 Ga0207674_10066657 3300026116 Bacteria 3626
54 Ga0209371_1000006 3300027312 Bacteria 1055642
55 Ga0268256_1000007 3300030500 Bacteria 1055326
56 Ga0307408_100000563 3300031548 Bacteria 31982
57 Ga0395899_0008931 3300037312 Bacteria 7714
58 Ga0395899_0158412 3300037312 Bacteria 1601
59 Ga0395900_0091341 3300037418 Bacteria 3129
60 Ga0395898_0210904 3300037466 Bacteria 1853
61 Ga0395905_0332699 3300037471 Bacteria 1409
62 Ga0237819_00847 3300038705 Bacteria 9639
63 Ga0439432_017466 3300042006 Bacteria 2407
64 Ga0450904_000366 3300042139 Bacteria 9499
65 Ga0466972_0009916 3300044658 Bacteria 4781
66 Ga0495607_0017794 3300046501 Bacteria 4550
67 Ga0495632_0012840 3300046519 Bacteria 4805
68 Ga0495632_0049891 3300046519 Bacteria 2066
69 Ga0495643_0008500 3300046522 Bacteria 6492
70 Ga0495663_0003532 3300046525 Bacteria 4501
71 Ga0495654_0020142 3300046530 Bacteria 3479
72 Ga0495633_0013205 3300046558 Bacteria 4361
73 Ga0495661_0021165 3300046665 Bacteria 4242
74 Ga0496116_0057197 3300048919 Bacteria 2551
75 Ga0496122_0045811 3300048925 Bacteria 3394
76 Ga0496123_0052369 3300048926 Bacteria 2709
77 Ga0501031_0002769 3300049568 Bacteria 11168
78 Ga0501031_0012439 3300049568 Bacteria 5552
79 Ga0501031_0114800 3300049568 Bacteria 1759
80 Ga0501032_0022038 3300049569 Bacteria 4422
81 Ga0501032_0028115 3300049569 Bacteria 3864
82 Ga0501032_0044529 3300049569 Bacteria 3003
83 Ga0501032_0090851 3300049569 Bacteria 2026
84 Ga0501033_0000446 3300049570 Bacteria 39481
85 Ga0501033_0003130 3300049570 Bacteria 13749
86 Ga0501033_0019827 3300049570 Bacteria 5083
87 Ga0501033_0029784 3300049570 Bacteria 4102
88 Ga0501033_0067051 3300049570 Bacteria 2639
89 Ga0501033_0083288 3300049570 Bacteria 2345
90 Ga0501033_0223763 3300049570 Bacteria 1338
91 Ga0501034_0004324 3300049571 Bacteria 15844
92 Ga0501034_0185096 3300049571 Bacteria 2047
93 Ga0501036_0005424 3300049572 Bacteria 10334
94 Ga0501036_0029074 3300049572 Bacteria 4672
95 Ga0501037_0000179 3300049573 Bacteria 58767
96 Ga0501037_0001481 3300049573 Bacteria 17182
97 Ga0501037_0077029 3300049573 Bacteria 2420
98 Ga0501037_0165894 3300049573 Bacteria 1573
99 Ga0501038_0026285 3300049574 Bacteria 5184
100 Ga0501038_0102463 3300049574 Bacteria 2382
101 Ga0501039_0001884 3300049575 Bacteria 15509
102 Ga0501042_0011846 3300049578 Bacteria 5889
103 Ga0501043_0000005 3300049579 Bacteria 254466
104 Ga0501043_0005191 3300049579 Bacteria 10540
105 Ga0501043_0008314 3300049579 Bacteria 8172
106 Ga0501046_0021898 3300049580 Bacteria 5269
107 Ga0501046_0049589 3300049580 Bacteria 3320
108 Ga0501047_0003716 3300049581 Bacteria 14368
109 Ga0501047_0043171 3300049581 Bacteria 4355
110 Ga0501047_0070774 3300049581 Bacteria 3358
111 Ga0501047_0114296 3300049581 Bacteria 2582
112 Ga0501047_0121847 3300049581 Bacteria 2489
113 Ga0501047_0292296 3300049581 Bacteria 1473
114 Ga0501068_0047823 3300049584 Bacteria 2581
115 Ga0501069_0000011 3300049585 Bacteria 153214
116 Ga0501069_0052286 3300049585 Bacteria 2274
117 Ga0501070_0001424 3300049586 Bacteria 21419
118 Ga0501070_0013988 3300049586 Bacteria 6756
119 Ga0501070_0047624 3300049586 Bacteria 3562
120 Ga0501070_0188915 3300049586 Bacteria 1694
121 Ga0501070_0292131 3300049586 Bacteria 1328
122 Ga0501073_0105441 3300049589 Bacteria 1956
123 Ga0501074_0000336 3300049590 Bacteria 27389
124 Ga0501080_0001369 3300049742 Bacteria 20402
125 Ga0501083_0000805 3300049744 Bacteria 20562
126 Ga0501035_0000107 3300049822 Bacteria 103130
127 Ga0501035_0007869 3300049822 Bacteria 9961
128 Ga0501035_0013853 3300049822 Bacteria 7443
129 Ga0501035_0015836 3300049822 Bacteria 6958
130 Ga0501035_0039263 3300049822 Bacteria 4284
131 Ga0501035_0060690 3300049822 Bacteria 3366
132 Ga0501044_0000154 3300049823 Bacteria 85407
133 Ga0501044_0005777 3300049823 Bacteria 13696
134 Ga0501044_0009552 3300049823 Bacteria 10560
135 Ga0501044_0026084 3300049823 Bacteria 6189
136 Ga0501044_0026244 3300049823 Bacteria 6168
137 Ga0501044_0151531 3300049823 Bacteria 2301
138 Ga0501044_0215300 3300049823 Bacteria 1874
139 Ga0501044_0279595 3300049823 Bacteria 1603
140 Ga0501045_0154331 3300049824 Bacteria 1708
141 Ga0501045_0320788 3300049824 Bacteria 1153
142 nmdc:mga03683_47509_c1 3300050489 Bacteria 1781
143 Ga0501082_0015310 3300060353 Bacteria 6603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0320788 Ga0501045_0320788_29_1078 308
2 3300005578 Ga0068854_100028644 Ga0068854_1000286443 340
3 3300009093 Ga0105240_10000739 Ga0105240_1000073951 340
4 3300009545 Ga0105237_10002121 Ga0105237_100021213 340
5 3300009551 Ga0105238_10061034 Ga0105238_100610343 340
6 3300010375 Ga0105239_10000454 Ga0105239_1000045451 340
7 3300025913 Ga0207695_10000788 Ga0207695_1000078836 340
8 3300025914 Ga0207671_10000411 Ga0207671_1000041151 340
9 3300025981 Ga0207640_10009624 Ga0207640_100096243 340
10 3300003214 JGI25165J46597_1000070 JGI25165J46597_1000070119 343
11 3300049568 Ga0501031_0114800 Ga0501031_0114800_18_1076 343
12 3300049586 Ga0501070_0188915 Ga0501070_0188915_328_1527 349
13 3300025261 Ga0209233_1000131 Ga0209233_1000131133 354
14 3300049823 Ga0501044_0151531 Ga0501044_0151531_859_2070 355
15 3300042006 Ga0439432_017466 Ga0439432_017466_241_1422 362
16 3300049569 Ga0501032_0028115 Ga0501032_0028115_714_1976 364
17 3300049579 Ga0501043_0008314 Ga0501043_0008314_1723_2985 364
18 3300049581 Ga0501047_0003716 Ga0501047_0003716_8154_9416 364
19 3300042139 Ga0450904_000366 Ga0450904_000366_2047_3276 366
20 3300003771 Ga0055526_1000541 Ga0055526_100054111 368
21 3300003775 Ga0055524_1000011 Ga0055524_1000011220 368
22 3300025291 Ga0209675_1000596 Ga0209675_10005965 368
23 3300025295 Ga0209564_1000369 Ga0209564_100036925 368
24 3300025299 Ga0209256_1000317 Ga0209256_100031765 368
25 3300049573 Ga0501037_0165894 Ga0501037_0165894_79_1284 371
26 3300049574 Ga0501038_0102463 Ga0501038_0102463_1082_2287 371
27 3300049822 Ga0501035_0015836 Ga0501035_0015836_3609_4814 371
28 3300049823 Ga0501044_0279595 Ga0501044_0279595_210_1433 371
29 iso_pu_bacteria 2551306352 2552747272 373
30 3300005577 Ga0068857_100050481 Ga0068857_1000504812 374
31 3300009174 Ga0105241_10029641 Ga0105241_100296412 374
32 3300009545 Ga0105237_10021656 Ga0105237_100216564 374
33 3300009551 Ga0105238_10032329 Ga0105238_100323292 374
34 3300025914 Ga0207671_10044338 Ga0207671_100443382 374
35 3300025924 Ga0207694_10019258 Ga0207694_100192582 374
36 3300026116 Ga0207674_10066657 Ga0207674_100666572 374
37 3300037471 Ga0395905_0332699 Ga0395905_0332699_77_1303 374
38 3300044658 Ga0466972_0009916 Ga0466972_0009916_366_1595 375
39 3300013249 Ga0171463_1005 Ga0171463_1005192 376
40 3300037312 Ga0395899_0158412 Ga0395899_0158412_353_1579 379
41 3300037418 Ga0395900_0091341 Ga0395900_0091341_914_2140 379
42 3300037466 Ga0395898_0210904 Ga0395898_0210904_349_1575 379
43 3300049581 Ga0501047_0043171 Ga0501047_0043171_2157_3353 381
44 iso_pu_bacteria 8004640170 8004642784 381
45 3300049586 Ga0501070_0013988 Ga0501070_0013988_4535_5755 382
46 3300003856 Ga0058692_1000010 Ga0058692_100001078 383
47 3300009036 Ga0105244_10009492 Ga0105244_100094925 383
48 3300009092 Ga0105250_10008840 Ga0105250_100088402 383
49 3300009093 Ga0105240_10120343 Ga0105240_101203433 383
50 3300013100 Ga0157373_10018501 Ga0157373_100185013 383
51 3300013102 Ga0157371_10017730 Ga0157371_100177303 383
52 3300025711 Ga0207696_1007558 Ga0207696_10075582 383
53 3300025728 Ga0207655_1014101 Ga0207655_10141015 383
54 3300027312 Ga0209371_1000006 Ga0209371_1000006650 383
55 3300030500 Ga0268256_1000007 Ga0268256_1000007650 383
56 3300046501 Ga0495607_0017794 Ga0495607_0017794_2244_3425 383
57 3300046519 Ga0495632_0012840 Ga0495632_0012840_1642_2823 383
58 3300046519 Ga0495632_0049891 Ga0495632_0049891_705_1886 383
59 3300046522 Ga0495643_0008500 Ga0495643_0008500_2300_3520 383
60 3300046525 Ga0495663_0003532 Ga0495663_0003532_2327_3508 383
61 3300046530 Ga0495654_0020142 Ga0495654_0020142_2030_3211 383
62 3300046558 Ga0495633_0013205 Ga0495633_0013205_683_1864 383
63 3300046665 Ga0495661_0021165 Ga0495661_0021165_566_1747 383
64 3300048919 Ga0496116_0057197 Ga0496116_0057197_1227_2408 383
65 3300048925 Ga0496122_0045811 Ga0496122_0045811_377_1558 383
66 3300048926 Ga0496123_0052369 Ga0496123_0052369_1003_2184 383
67 3300050489 nmdc:mga03683_47509_c1 nmdc:mga03683_47509_c1_453_1634 383
68 iso_pu_bacteria 2939631187 2939631235 384
69 iso_pu_bacteria 8057101203 8057101967 384
70 iso_pu_bacteria 2599185352 2600196261 385
71 iso_pu_bacteria 2643221618 2644106053 385
72 iso_pu_bacteria 2643221626 2644146984 385
73 iso_pu_bacteria 2643221637 2644208385 385
74 iso_pu_bacteria 2643221655 2644310664 385
75 iso_pu_bacteria 2643221659 2644334549 385
76 iso_pu_bacteria 2643221698 2644545252 385
77 iso_pu_bacteria 2643221712 2644616498 385
78 iso_pu_bacteria 2643221718 2644651636 385
79 iso_pu_bacteria 2643221723 2644673344 385
80 iso_pu_bacteria 2920822456 2920822677 385
81 3300002987 JGI25159J45721_1000024 JGI25159J45721_100002470 386
82 3300003354 JGI25160J50197_1000063 JGI25160J50197_100006346 386
83 3300003771 Ga0055526_1005378 Ga0055526_10053784 386
84 3300004625 Ga0055543_1000124 Ga0055543_100012446 386
85 3300005262 Ga0065165_1000163 Ga0065165_100016369 386
86 3300015690 Ga0183363_1090 Ga0183363_109019 386
87 3300025208 Ga0209436_102817 Ga0209436_1028172 386
88 3300025284 Ga0209130_1000138 Ga0209130_100013865 386
89 3300025294 Ga0209025_1001231 Ga0209025_100123123 386
90 3300025295 Ga0209564_1000250 Ga0209564_100025043 386
91 3300025302 Ga0207426_1000255 Ga0207426_100025565 386
92 3300025304 Ga0209257_1011682 Ga0209257_10116823 386
93 iso_pu_bacteria 2894023352 2894025947 386
94 iso_pu_bacteria 2996336353 2996338876 386
95 3300049571 Ga0501034_0004324 Ga0501034_0004324_13757_14989 387
96 3300049586 Ga0501070_0047624 Ga0501070_0047624_524_1720 387
97 iso_pu_bacteria 2728368998 2728749168 387
98 3300049569 Ga0501032_0044529 Ga0501032_0044529_1619_2812 388
99 3300049570 Ga0501033_0029784 Ga0501033_0029784_1202_2395 388
100 3300049570 Ga0501033_0223763 Ga0501033_0223763_80_1273 388
101 3300049571 Ga0501034_0185096 Ga0501034_0185096_787_1980 388
102 3300049572 Ga0501036_0029074 Ga0501036_0029074_1863_3056 388
103 3300049581 Ga0501047_0070774 Ga0501047_0070774_1376_2569 388
104 3300049581 Ga0501047_0121847 Ga0501047_0121847_273_1466 388
105 3300049822 Ga0501035_0039263 Ga0501035_0039263_2562_3755 388
106 3300049823 Ga0501044_0009552 Ga0501044_0009552_3479_4717 388
107 3300049823 Ga0501044_0026244 Ga0501044_0026244_1106_2299 388
108 3300025228 Ga0209672_101702 Ga0209672_1017026 390
109 3300025272 Ga0209455_1003321 Ga0209455_10033212 390
110 3300049573 Ga0501037_0077029 Ga0501037_0077029_231_1430 390
111 3300049822 Ga0501035_0013853 Ga0501035_0013853_3141_4343 390
112 iso_pu_bacteria 2534681796 2535517451 390
113 iso_pu_bacteria 2751185821 2753461230 390
114 iso_pu_bacteria 8005542996 8005546267 390
115 iso_pu_bacteria 2643221550 2643772220 391
116 3300049822 Ga0501035_0060690 Ga0501035_0060690_1135_2349 392
117 iso_pu_bacteria 2693429783 2694634053 392
118 iso_pu_bacteria 2693429784 2694638577 392
119 iso_pu_bacteria 2917699015 2917702685 392
120 3300031548 Ga0307408_100000563 Ga0307408_10000056318 394
121 3300049570 Ga0501033_0019827 Ga0501033_0019827_1265_2488 395
122 3300049581 Ga0501047_0292296 Ga0501047_0292296_39_1262 395
123 3300049585 Ga0501069_0052286 Ga0501069_0052286_465_1685 395
124 3300049586 Ga0501070_0292131 Ga0501070_0292131_29_1249 395
125 3300049823 Ga0501044_0026084 Ga0501044_0026084_4593_5816 395
126 3300049823 Ga0501044_0215300 Ga0501044_0215300_223_1461 396
127 3300049570 Ga0501033_0067051 Ga0501033_0067051_655_1884 397
128 3300049581 Ga0501047_0114296 Ga0501047_0114296_699_1928 397
129 iso_pu_bacteria 2617270742 2617381090 397
130 iso_pu_bacteria 2775507266 2778176570 397
131 iso_pu_bacteria 2842482326 2842484267 397
132 3300009093 Ga0105240_10122001 Ga0105240_101220012 398
133 3300049570 Ga0501033_0083288 Ga0501033_0083288_958_2205 398
134 3300049580 Ga0501046_0049589 Ga0501046_0049589_1655_2878 398
135 3300005455 Ga0070663_100013889 Ga0070663_1000138893 400
136 3300026067 Ga0207678_10045408 Ga0207678_100454083 400
137 3300049568 Ga0501031_0002769 Ga0501031_0002769_7374_8624 400
138 3300049568 Ga0501031_0012439 Ga0501031_0012439_1233_2489 400
139 3300049569 Ga0501032_0022038 Ga0501032_0022038_2809_4065 400
140 3300049569 Ga0501032_0090851 Ga0501032_0090851_265_1515 400
141 3300049570 Ga0501033_0000446 Ga0501033_0000446_9248_10498 400
142 3300049570 Ga0501033_0003130 Ga0501033_0003130_454_1710 400
143 3300049572 Ga0501036_0005424 Ga0501036_0005424_7652_8902 400
144 3300049573 Ga0501037_0000179 Ga0501037_0000179_50152_51402 400
145 3300049573 Ga0501037_0001481 Ga0501037_0001481_6851_8107 400
146 3300049574 Ga0501038_0026285 Ga0501038_0026285_2348_3598 400
147 3300049575 Ga0501039_0001884 Ga0501039_0001884_9982_11232 400
148 3300049578 Ga0501042_0011846 Ga0501042_0011846_326_1576 400
149 3300049579 Ga0501043_0000005 Ga0501043_0000005_94875_96131 400
150 3300049579 Ga0501043_0005191 Ga0501043_0005191_7375_8625 400
151 3300049580 Ga0501046_0021898 Ga0501046_0021898_973_2223 400
152 3300049584 Ga0501068_0047823 Ga0501068_0047823_604_1854 400
153 3300049585 Ga0501069_0000011 Ga0501069_0000011_90186_91442 400
154 3300049586 Ga0501070_0001424 Ga0501070_0001424_11094_12350 400
155 3300049589 Ga0501073_0105441 Ga0501073_0105441_221_1471 400
156 3300049590 Ga0501074_0000336 Ga0501074_0000336_8998_10254 400
157 3300049742 Ga0501080_0001369 Ga0501080_0001369_6956_8212 400
158 3300049744 Ga0501083_0000805 Ga0501083_0000805_9068_10324 400
159 3300049822 Ga0501035_0000107 Ga0501035_0000107_91083_92339 400
160 3300049822 Ga0501035_0007869 Ga0501035_0007869_7123_8373 400
161 3300049823 Ga0501044_0000154 Ga0501044_0000154_13617_14873 400
162 3300049823 Ga0501044_0005777 Ga0501044_0005777_1672_2922 400
163 3300049824 Ga0501045_0154331 Ga0501045_0154331_327_1577 400
164 3300060353 Ga0501082_0015310 Ga0501082_0015310_2325_3581 400
165 3300002737 JGI25162J39368_1000111 JGI25162J39368_100011110 401
166 3300025207 Ga0209760_100795 Ga0209760_1007952 401
167 3300025231 Ga0207427_106353 Ga0207427_1063532 401
168 3300025233 Ga0209437_100064 Ga0209437_10006478 401
169 3300025261 Ga0209233_1000081 Ga0209233_1000081224 401
170 3300037312 Ga0395899_0008931 Ga0395899_0008931_5278_6546 401
171 3300038705 Ga0237819_00847 Ga0237819_00847_8331_9593 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

17

348

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8462 12 369
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8144 11 369
6oom-assembly2.cif.gz_A-2 protein a 0.8136 12 369
6vs2-assembly1.cif.gz_A protein d 0.8129 11 370
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.809 14 370
ID Description Score Start End Superfamily
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.966 196 374 1.20.1250.20
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9403 196 374 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9337 13 186 1.20.1250.20
af_P76242_7_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9014 11 369 1.20.1250.20
af_Q54YF6_171_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8922 13 177 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3G2T4L4-F1-model_v4 MFS transporter 0.9745 11 381 GO:0016020
GO:0022857
AF-A0A334NA36-F1-model_v4 deleted 0.9701 11 382
AF-A0A009QMF1-F1-model_v4 Major Facilitator Superfamily protein 0.9695 11 382 GO:0016020
GO:0022857
AF-A0A0Q9J9V0-F1-model_v4 MFS transporter 0.9671 13 379 GO:0016020
GO:0022857
AF-U1ZTH3-F1-model_v4 Major facilitator transporter 0.966 12 382 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map