F259407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 171 | 132 | 342 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0033773|Ga0495670_0033773_1434_2495 |
| Length | 344 |
| Sequence | VRPDALARLAEQSALMGTSHRQKPVRDLVARVRGGLADLFSLPDGYEIVLGNGGTTAFWDAAAAWLVRERALHLSYGEFSQKFAKVTAAAPFLADSILVEADPGDAPAPVWAHNETSTGVMVAVARPEGAGEALVLVDATSGAGGLPLDASQADAYYFAPQKAFGADGGLWLAALSPAAIARIEQLDGAADRWQPAFLSLQTALENSRKEQTYNTPALATLLLLADQVEWMLAGGGLNWCVERTSASSGHLYGWAERTDFASPFVADPAKRSLVVGTIDFDDSVDAAAVAATLRANGIVDVEPYRKLGRNQLRIGMFPSVEPADVEALTACIDWVVENVGEARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 16 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 17 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 18 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 19 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 20 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 23 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 55 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 56 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 57 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 58 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 59 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 60 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 61 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 62 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 63 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 64 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 65 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 68 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 69 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 71 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 72 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 73 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 74 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 75 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 109 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 110 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 111 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 112 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 115 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 116 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 117 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 118 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 119 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 120 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 126 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.51 |
| Nodule | 0 |
| Rhizoplane | 12.28 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495670_0033773 | 3300046691 | Bacteria | 2546 |
| 2 | JGI24034J26672_10000377 | 3300002239 | Bacteria | 5789 |
| 3 | Ga0068868_100000633 | 3300005338 | Bacteria | 23661 |
| 4 | Ga0070691_10009524 | 3300005341 | Bacteria | 4435 |
| 5 | Ga0070691_10027617 | 3300005341 | Bacteria | 2649 |
| 6 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 7 | Ga0070673_100000474 | 3300005364 | Bacteria | 21373 |
| 8 | Ga0070714_100186178 | 3300005435 | Bacteria | 1892 |
| 9 | Ga0070663_100125718 | 3300005455 | Bacteria | 1942 |
| 10 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 11 | Ga0070681_10003891 | 3300005458 | Bacteria | 14065 |
| 12 | Ga0068867_100002668 | 3300005459 | Bacteria | 12591 |
| 13 | Ga0070679_100000844 | 3300005530 | Bacteria | 26718 |
| 14 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 15 | Ga0070664_100038179 | 3300005564 | Bacteria | 4042 |
| 16 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 17 | Ga0068858_100001009 | 3300005842 | Bacteria | 29022 |
| 18 | Ga0068860_100118890 | 3300005843 | Bacteria | 2530 |
| 19 | Ga0075365_10030559 | 3300006038 | Bacteria | 3451 |
| 20 | Ga0075365_10092060 | 3300006038 | Bacteria | 2067 |
| 21 | Ga0075364_10054857 | 3300006051 | Bacteria | 2607 |
| 22 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 23 | Ga0097621_100116678 | 3300006237 | Bacteria | 2261 |
| 24 | Ga0068871_100340113 | 3300006358 | Bacteria | 1325 |
| 25 | Ga0075433_10000244 | 3300006852 | Bacteria | 31446 |
| 26 | Ga0105240_10337301 | 3300009093 | Bacteria | 1713 |
| 27 | Ga0105245_10071389 | 3300009098 | Bacteria | 3153 |
| 28 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 29 | Ga0105249_10059376 | 3300009553 | Bacteria | 3507 |
| 30 | Ga0157374_10001900 | 3300013296 | Bacteria | 17502 |
| 31 | Ga0157375_10008154 | 3300013308 | Bacteria | 9167 |
| 32 | Ga0157380_10000507 | 3300014326 | Bacteria | 23819 |
| 33 | Ga0157379_10014841 | 3300014968 | Bacteria | 6832 |
| 34 | Ga0163161_10000160 | 3300017792 | Bacteria | 62228 |
| 35 | Ga0207682_10000140 | 3300025893 | Bacteria | 32624 |
| 36 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 37 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 38 | Ga0207695_10254870 | 3300025913 | Bacteria | 1653 |
| 39 | Ga0207663_10000748 | 3300025916 | Bacteria | 14481 |
| 40 | Ga0207694_10000056 | 3300025924 | Bacteria | 146908 |
| 41 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 42 | Ga0207687_10001900 | 3300025927 | Bacteria | 14372 |
| 43 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 44 | Ga0207686_10000199 | 3300025934 | Bacteria | 46373 |
| 45 | Ga0207670_10056756 | 3300025936 | Bacteria | 2653 |
| 46 | Ga0207669_10000131 | 3300025937 | Bacteria | 37319 |
| 47 | Ga0207661_10067537 | 3300025944 | Bacteria | 2908 |
| 48 | Ga0207679_10020749 | 3300025945 | Bacteria | 4440 |
| 49 | Ga0207651_10000664 | 3300025960 | Bacteria | 14678 |
| 50 | Ga0207677_10001178 | 3300026023 | Bacteria | 14220 |
| 51 | Ga0207703_10000166 | 3300026035 | Bacteria | 76553 |
| 52 | Ga0207639_10210063 | 3300026041 | Bacteria | 1675 |
| 53 | Ga0207678_10105781 | 3300026067 | Bacteria | 2401 |
| 54 | Ga0207702_10004436 | 3300026078 | Bacteria | 12465 |
| 55 | Ga0207648_10001799 | 3300026089 | Bacteria | 23490 |
| 56 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 57 | Ga0265337_1000805 | 3300028556 | Bacteria | 16508 |
| 58 | Ga0265326_10000084 | 3300028558 | Bacteria | 50129 |
| 59 | Ga0265322_10000198 | 3300028654 | Bacteria | 26588 |
| 60 | Ga0265324_10023816 | 3300029957 | Bacteria | 2178 |
| 61 | Ga0265332_10037936 | 3300031238 | Bacteria | 2089 |
| 62 | Ga0265328_10017656 | 3300031239 | Bacteria | 2761 |
| 63 | Ga0265320_10000035 | 3300031240 | Bacteria | 137855 |
| 64 | Ga0265329_10019214 | 3300031242 | Bacteria | 2323 |
| 65 | Ga0265331_10023158 | 3300031250 | Bacteria | 3160 |
| 66 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 67 | Ga0265316_10027343 | 3300031344 | Bacteria | 4725 |
| 68 | Ga0265313_10109429 | 3300031595 | Bacteria | 1216 |
| 69 | Ga0265314_10000690 | 3300031711 | Bacteria | 40955 |
| 70 | Ga0265342_10118561 | 3300031712 | Bacteria | 1492 |
| 71 | Ga0373955_0028899 | 3300035172 | Bacteria | 2879 |
| 72 | Ga0373937_0007200 | 3300036401 | Bacteria | 9627 |
| 73 | Ga0373937_0285134 | 3300036401 | Bacteria | 1560 |
| 74 | Ga0451853_1338654 | 3300041512 | Bacteria | 1858 |
| 75 | Ga0466963_0000022 | 3300044694 | Bacteria | 52600 |
| 76 | Ga0466963_0066096 | 3300044694 | Bacteria | 2425 |
| 77 | Ga0466963_0106532 | 3300044694 | Bacteria | 1922 |
| 78 | Ga0466971_0012532 | 3300044719 | Bacteria | 3718 |
| 79 | Ga0466960_0000033 | 3300044901 | Bacteria | 46153 |
| 80 | Ga0466960_0057097 | 3300044901 | Bacteria | 1902 |
| 81 | Ga0466967_0326441 | 3300045976 | Bacteria | 1481 |
| 82 | Ga0495592_0000912 | 3300046454 | Bacteria | 20489 |
| 83 | Ga0495629_0022340 | 3300046459 | Bacteria | 4511 |
| 84 | Ga0495638_0093251 | 3300046460 | Bacteria | 1811 |
| 85 | Ga0495651_0138823 | 3300046462 | Bacteria | 1765 |
| 86 | Ga0495653_0033150 | 3300046463 | Bacteria | 4094 |
| 87 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 88 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 89 | Ga0495662_0000133 | 3300046476 | Bacteria | 28271 |
| 90 | Ga0495594_0125555 | 3300046499 | Bacteria | 1452 |
| 91 | Ga0495608_0003019 | 3300046511 | Bacteria | 12014 |
| 92 | Ga0495608_0037719 | 3300046511 | Bacteria | 3249 |
| 93 | Ga0495620_0002158 | 3300046515 | Bacteria | 11431 |
| 94 | Ga0495628_0022200 | 3300046516 | Bacteria | 5216 |
| 95 | Ga0495628_0078105 | 3300046516 | Bacteria | 2574 |
| 96 | Ga0495628_0154434 | 3300046516 | Bacteria | 1747 |
| 97 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 98 | Ga0495630_0003163 | 3300046517 | Bacteria | 11429 |
| 99 | Ga0495630_0064844 | 3300046517 | Bacteria | 2745 |
| 100 | Ga0495652_0004585 | 3300046529 | Bacteria | 13174 |
| 101 | Ga0495640_0007812 | 3300046533 | Bacteria | 8414 |
| 102 | Ga0495587_0074999 | 3300046536 | Bacteria | 1964 |
| 103 | Ga0495621_0001449 | 3300046539 | Bacteria | 6146 |
| 104 | Ga0495645_0032740 | 3300046543 | Bacteria | 3792 |
| 105 | Ga0495645_0073531 | 3300046543 | Bacteria | 2462 |
| 106 | Ga0495645_0103932 | 3300046543 | Bacteria | 2018 |
| 107 | Ga0495656_0000295 | 3300046615 | Bacteria | 17274 |
| 108 | Ga0495634_0010503 | 3300046642 | Bacteria | 6783 |
| 109 | Ga0495657_0006985 | 3300046675 | Bacteria | 8756 |
| 110 | Ga0495657_0155255 | 3300046675 | Bacteria | 1419 |
| 111 | Ga0495647_0000043 | 3300046681 | Bacteria | 36874 |
| 112 | Ga0495658_0000193 | 3300046683 | Bacteria | 35142 |
| 113 | Ga0495669_0000102 | 3300046684 | Bacteria | 53777 |
| 114 | Ga0495613_0000282 | 3300046689 | Bacteria | 47001 |
| 115 | Ga0495613_0030444 | 3300046689 | Bacteria | 4009 |
| 116 | Ga0495613_0074173 | 3300046689 | Bacteria | 2478 |
| 117 | Ga0495613_0111304 | 3300046689 | Bacteria | 1972 |
| 118 | Ga0495613_0162278 | 3300046689 | Bacteria | 1589 |
| 119 | Ga0495624_0006535 | 3300046690 | Bacteria | 8263 |
| 120 | Ga0495600_0001288 | 3300046809 | Bacteria | 13857 |
| 121 | Ga0495600_0299081 | 3300046809 | Bacteria | 1015 |
| 122 | Ga0495604_0000267 | 3300047317 | Bacteria | 46398 |
| 123 | Ga0495604_0028724 | 3300047317 | Bacteria | 4425 |
| 124 | Ga0495676_0001626 | 3300047321 | Bacteria | 19533 |
| 125 | Ga0495676_0010974 | 3300047321 | Bacteria | 8192 |
| 126 | Ga0495676_0018201 | 3300047321 | Bacteria | 6197 |
| 127 | Ga0495680_0000193 | 3300047322 | Bacteria | 65567 |
| 128 | Ga0495680_0005500 | 3300047322 | Bacteria | 11903 |
| 129 | Ga0495679_023349 | 3300047446 | Bacteria | 2099 |
| 130 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 131 | Ga0496100_0000014 | 3300048903 | Bacteria | 174991 |
| 132 | Ga0496101_0000036 | 3300048904 | Bacteria | 175595 |
| 133 | Ga0496101_0000493 | 3300048904 | Bacteria | 24897 |
| 134 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 135 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 136 | Ga0496106_0000043 | 3300048909 | Bacteria | 105477 |
| 137 | Ga0496106_0000193 | 3300048909 | Bacteria | 42951 |
| 138 | Ga0496106_0001892 | 3300048909 | Bacteria | 15675 |
| 139 | Ga0496107_0000094 | 3300048910 | Bacteria | 42797 |
| 140 | Ga0496107_0000271 | 3300048910 | Bacteria | 27463 |
| 141 | Ga0496108_0001109 | 3300048911 | Bacteria | 21079 |
| 142 | Ga0496108_0051885 | 3300048911 | Bacteria | 3436 |
| 143 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 144 | Ga0496109_0001414 | 3300048912 | Bacteria | 19912 |
| 145 | Ga0496110_0185063 | 3300048913 | Bacteria | 1891 |
| 146 | Ga0496113_0099741 | 3300048916 | Bacteria | 2249 |
| 147 | Ga0496113_0245217 | 3300048916 | Bacteria | 1430 |
| 148 | Ga0496114_0018100 | 3300048917 | Bacteria | 5693 |
| 149 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 150 | Ga0496115_0001569 | 3300048918 | Bacteria | 16428 |
| 151 | Ga0496119_0000055 | 3300048922 | Bacteria | 180121 |
| 152 | Ga0496125_0052525 | 3300048928 | Bacteria | 3351 |
| 153 | Ga0501034_0019495 | 3300049571 | Bacteria | 6937 |
| 154 | Ga0501034_0228135 | 3300049571 | Bacteria | 1812 |
| 155 | Ga0501047_0046520 | 3300049581 | Bacteria | 4194 |
| 156 | Ga0501075_0003224 | 3300049591 | Bacteria | 10913 |
| 157 | Ga0501081_0066390 | 3300049743 | Bacteria | 2509 |
| 158 | Ga0501044_0015577 | 3300049823 | Bacteria | 8192 |
| 159 | nmdc:mga0yw44_33607_c1 | 3300050492 | Bacteria | 2998 |
| 160 | nmdc:mga0yw44_94602_c1 | 3300050492 | Bacteria | 1894 |
| 161 | nmdc:mga0a205_45_c1 | 3300050515 | Bacteria | 68070 |
| 162 | Ga0495601_0000156 | 3300053077 | Bacteria | 38350 |
| 163 | Ga0495612_0003529 | 3300053078 | Bacteria | 6484 |
| 164 | Ga0495655_0000023 | 3300053083 | Bacteria | 39507 |
| 165 | Ga0495595_0000200 | 3300053084 | Bacteria | 24133 |
| 166 | Ga0495595_0023189 | 3300053084 | Bacteria | 2730 |
| 167 | Ga0495619_0000602 | 3300053085 | Bacteria | 23838 |
| 168 | Ga0495619_0002992 | 3300053085 | Bacteria | 10976 |
| 169 | Ga0495619_0003076 | 3300053085 | Bacteria | 10833 |
| 170 | Ga0495619_0025796 | 3300053085 | Bacteria | 3777 |
| 171 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 172 | Ga0495670_0033773 | |||
| 173 | JGI24034J26672_10000377 | |||
| 174 | Ga0068868_100000633 | |||
| 175 | Ga0070691_10009524 | |||
| 176 | Ga0070691_10027617 | |||
| 177 | Ga0070674_100000004 | |||
| 178 | Ga0070673_100000474 | |||
| 179 | Ga0070714_100186178 | |||
| 180 | Ga0070663_100125718 | |||
| 181 | Ga0070662_100000006 | |||
| 182 | Ga0070681_10003891 | |||
| 183 | Ga0068867_100002668 | |||
| 184 | Ga0070679_100000844 | |||
| 185 | Ga0070665_100000040 | |||
| 186 | Ga0070664_100038179 | |||
| 187 | Ga0068866_10000004 | |||
| 188 | Ga0068858_100001009 | |||
| 189 | Ga0068860_100118890 | |||
| 190 | Ga0075365_10030559 | |||
| 191 | Ga0075365_10092060 | |||
| 192 | Ga0075364_10054857 | |||
| 193 | Ga0070715_10000014 | |||
| 194 | Ga0097621_100116678 | |||
| 195 | Ga0068871_100340113 | |||
| 196 | Ga0075433_10000244 | |||
| 197 | Ga0105240_10337301 | |||
| 198 | Ga0105245_10071389 | |||
| 199 | Ga0105238_10000048 | |||
| 200 | Ga0105249_10059376 | |||
| 201 | Ga0157374_10001900 | |||
| 202 | Ga0157375_10008154 | |||
| 203 | Ga0157380_10000507 | |||
| 204 | Ga0157379_10014841 | |||
| 205 | Ga0163161_10000160 | |||
| 206 | Ga0207682_10000140 | |||
| 207 | Ga0207642_10000005 | |||
| 208 | Ga0207685_10000025 | |||
| 209 | Ga0207695_10254870 | |||
| 210 | Ga0207663_10000748 | |||
| 211 | Ga0207694_10000056 | |||
| 212 | Ga0207687_10000020 | |||
| 213 | Ga0207687_10001900 | |||
| 214 | Ga0207706_10000017 | |||
| 215 | Ga0207686_10000199 | |||
| 216 | Ga0207670_10056756 | |||
| 217 | Ga0207669_10000131 | |||
| 218 | Ga0207661_10067537 | |||
| 219 | Ga0207679_10020749 | |||
| 220 | Ga0207651_10000664 | |||
| 221 | Ga0207677_10001178 | |||
| 222 | Ga0207703_10000166 | |||
| 223 | Ga0207639_10210063 | |||
| 224 | Ga0207678_10105781 | |||
| 225 | Ga0207702_10004436 | |||
| 226 | Ga0207648_10001799 | |||
| 227 | Ga0268266_10000045 | |||
| 228 | Ga0265337_1000805 | |||
| 229 | Ga0265326_10000084 | |||
| 230 | Ga0265322_10000198 | |||
| 231 | Ga0265324_10023816 | |||
| 232 | Ga0265332_10037936 | |||
| 233 | Ga0265328_10017656 | |||
| 234 | Ga0265320_10000035 | |||
| 235 | Ga0265329_10019214 | |||
| 236 | Ga0265331_10023158 | |||
| 237 | Ga0265327_10000015 | |||
| 238 | Ga0265316_10027343 | |||
| 239 | Ga0265313_10109429 | |||
| 240 | Ga0265314_10000690 | |||
| 241 | Ga0265342_10118561 | |||
| 242 | Ga0373955_0028899 | |||
| 243 | Ga0373937_0007200 | |||
| 244 | Ga0373937_0285134 | |||
| 245 | Ga0451853_1338654 | |||
| 246 | Ga0466963_0000022 | |||
| 247 | Ga0466963_0066096 | |||
| 248 | Ga0466963_0106532 | |||
| 249 | Ga0466971_0012532 | |||
| 250 | Ga0466960_0000033 | |||
| 251 | Ga0466960_0057097 | |||
| 252 | Ga0466967_0326441 | |||
| 253 | Ga0495592_0000912 | |||
| 254 | Ga0495629_0022340 | |||
| 255 | Ga0495638_0093251 | |||
| 256 | Ga0495651_0138823 | |||
| 257 | Ga0495653_0033150 | |||
| 258 | Ga0495650_0000398 | |||
| 259 | Ga0495582_0000001 | |||
| 260 | Ga0495662_0000133 | |||
| 261 | Ga0495594_0125555 | |||
| 262 | Ga0495608_0003019 | |||
| 263 | Ga0495608_0037719 | |||
| 264 | Ga0495620_0002158 | |||
| 265 | Ga0495628_0022200 | |||
| 266 | Ga0495628_0078105 | |||
| 267 | Ga0495628_0154434 | |||
| 268 | Ga0495630_0000012 | |||
| 269 | Ga0495630_0003163 | |||
| 270 | Ga0495630_0064844 | |||
| 271 | Ga0495652_0004585 | |||
| 272 | Ga0495640_0007812 | |||
| 273 | Ga0495587_0074999 | |||
| 274 | Ga0495621_0001449 | |||
| 275 | Ga0495645_0032740 | |||
| 276 | Ga0495645_0073531 | |||
| 277 | Ga0495645_0103932 | |||
| 278 | Ga0495656_0000295 | |||
| 279 | Ga0495634_0010503 | |||
| 280 | Ga0495657_0006985 | |||
| 281 | Ga0495657_0155255 | |||
| 282 | Ga0495647_0000043 | |||
| 283 | Ga0495658_0000193 | |||
| 284 | Ga0495669_0000102 | |||
| 285 | Ga0495613_0000282 | |||
| 286 | Ga0495613_0030444 | |||
| 287 | Ga0495613_0074173 | |||
| 288 | Ga0495613_0111304 | |||
| 289 | Ga0495613_0162278 | |||
| 290 | Ga0495624_0006535 | |||
| 291 | Ga0495600_0001288 | |||
| 292 | Ga0495600_0299081 | |||
| 293 | Ga0495604_0000267 | |||
| 294 | Ga0495604_0028724 | |||
| 295 | Ga0495676_0001626 | |||
| 296 | Ga0495676_0010974 | |||
| 297 | Ga0495676_0018201 | |||
| 298 | Ga0495680_0000193 | |||
| 299 | Ga0495680_0005500 | |||
| 300 | Ga0495679_023349 | |||
| 301 | Ga0496100_0000005 | |||
| 302 | Ga0496100_0000014 | |||
| 303 | Ga0496101_0000036 | |||
| 304 | Ga0496101_0000493 | |||
| 305 | Ga0496104_0000024 | |||
| 306 | Ga0496105_0000013 | |||
| 307 | Ga0496106_0000043 | |||
| 308 | Ga0496106_0000193 | |||
| 309 | Ga0496106_0001892 | |||
| 310 | Ga0496107_0000094 | |||
| 311 | Ga0496107_0000271 | |||
| 312 | Ga0496108_0001109 | |||
| 313 | Ga0496108_0051885 | |||
| 314 | Ga0496109_0000004 | |||
| 315 | Ga0496109_0001414 | |||
| 316 | Ga0496110_0185063 | |||
| 317 | Ga0496113_0099741 | |||
| 318 | Ga0496113_0245217 | |||
| 319 | Ga0496114_0018100 | |||
| 320 | Ga0496115_0000010 | |||
| 321 | Ga0496115_0001569 | |||
| 322 | Ga0496119_0000055 | |||
| 323 | Ga0496125_0052525 | |||
| 324 | Ga0501034_0019495 | |||
| 325 | Ga0501034_0228135 | |||
| 326 | Ga0501047_0046520 | |||
| 327 | Ga0501075_0003224 | |||
| 328 | Ga0501081_0066390 | |||
| 329 | Ga0501044_0015577 | |||
| 330 | nmdc:mga0yw44_33607_c1 | |||
| 331 | nmdc:mga0yw44_94602_c1 | |||
| 332 | nmdc:mga0a205_45_c1 | |||
| 333 | Ga0495601_0000156 | |||
| 334 | Ga0495612_0003529 | |||
| 335 | Ga0495655_0000023 | |||
| 336 | Ga0495595_0000200 | |||
| 337 | Ga0495595_0023189 | |||
| 338 | Ga0495619_0000602 | |||
| 339 | Ga0495619_0002992 | |||
| 340 | Ga0495619_0003076 | |||
| 341 | Ga0495619_0025796 | |||
| 342 | Ga0500628_000001 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9706 | 7 | 372 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9703 | 7 | 372 |
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9628 | 7 | 372 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9599 | 7 | 372 |
| 3ffr-assembly1.cif.gz_A-2 | crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution | 0.8889 | 23 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.976 | 30 | 266 | 3.20.10.10 |
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.964 | 30 | 266 | 3.20.10.10 |
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9585 | 270 | 372 | 3.90.1150.10 |
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9322 | 270 | 372 | 3.90.1150.10 |
| 3ffrA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8749 | 30 | 264 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3FJM8-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9842 | 50 | 203 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A2S9FBJ7-F1-model_v4 | phosphoserine transaminase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) | 0.9831 | 49 | 373 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0008615 GO:0019265 |
| AF-A0A7G1I7M0-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9817 | 99 | 197 |
|
| AF-A0A7W1KBB2-F1-model_v4 | Phosphoserine transaminase (EC 2.6.1.52) | 0.9814 | 92 | 372 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0008615 GO:0019265 |
| AF-A0A6J6HXD8-F1-model_v4 | Unannotated protein | 0.9792 | 77 | 373 |
GO:0004648
GO:0004760 GO:0005777 GO:0006564 GO:0008453 GO:0019265 |