F259407

General Info

Members Datasets Scaffolds Average Seq Length
171 132 342 377

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0033773|Ga0495670_0033773_1434_2495
Length 344
Sequence VRPDALARLAEQSALMGTSHRQKPVRDLVARVRGGLADLFSLPDGYEIVLGNGGTTAFWDAAAAWLVRERALHLSYGEFSQKFAKVTAAAPFLADSILVEADPGDAPAPVWAHNETSTGVMVAVARPEGAGEALVLVDATSGAGGLPLDASQADAYYFAPQKAFGADGGLWLAALSPAAIARIEQLDGAADRWQPAFLSLQTALENSRKEQTYNTPALATLLLLADQVEWMLAGGGLNWCVERTSASSGHLYGWAERTDFASPFVADPAKRSLVVGTIDFDDSVDAAAVAATLRANGIVDVEPYRKLGRNQLRIGMFPSVEPADVEALTACIDWVVENVGEARS

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 12.28
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0033773 3300046691 Bacteria 2546
2 JGI24034J26672_10000377 3300002239 Bacteria 5789
3 Ga0068868_100000633 3300005338 Bacteria 23661
4 Ga0070691_10009524 3300005341 Bacteria 4435
5 Ga0070691_10027617 3300005341 Bacteria 2649
6 Ga0070674_100000004 3300005356 Bacteria 169446
7 Ga0070673_100000474 3300005364 Bacteria 21373
8 Ga0070714_100186178 3300005435 Bacteria 1892
9 Ga0070663_100125718 3300005455 Bacteria 1942
10 Ga0070662_100000006 3300005457 Bacteria 169366
11 Ga0070681_10003891 3300005458 Bacteria 14065
12 Ga0068867_100002668 3300005459 Bacteria 12591
13 Ga0070679_100000844 3300005530 Bacteria 26718
14 Ga0070665_100000040 3300005548 Bacteria 305480
15 Ga0070664_100038179 3300005564 Bacteria 4042
16 Ga0068866_10000004 3300005718 Bacteria 202810
17 Ga0068858_100001009 3300005842 Bacteria 29022
18 Ga0068860_100118890 3300005843 Bacteria 2530
19 Ga0075365_10030559 3300006038 Bacteria 3451
20 Ga0075365_10092060 3300006038 Bacteria 2067
21 Ga0075364_10054857 3300006051 Bacteria 2607
22 Ga0070715_10000014 3300006163 Bacteria 154272
23 Ga0097621_100116678 3300006237 Bacteria 2261
24 Ga0068871_100340113 3300006358 Bacteria 1325
25 Ga0075433_10000244 3300006852 Bacteria 31446
26 Ga0105240_10337301 3300009093 Bacteria 1713
27 Ga0105245_10071389 3300009098 Bacteria 3153
28 Ga0105238_10000048 3300009551 Bacteria 146322
29 Ga0105249_10059376 3300009553 Bacteria 3507
30 Ga0157374_10001900 3300013296 Bacteria 17502
31 Ga0157375_10008154 3300013308 Bacteria 9167
32 Ga0157380_10000507 3300014326 Bacteria 23819
33 Ga0157379_10014841 3300014968 Bacteria 6832
34 Ga0163161_10000160 3300017792 Bacteria 62228
35 Ga0207682_10000140 3300025893 Bacteria 32624
36 Ga0207642_10000005 3300025899 Bacteria 401934
37 Ga0207685_10000025 3300025905 Bacteria 110358
38 Ga0207695_10254870 3300025913 Bacteria 1653
39 Ga0207663_10000748 3300025916 Bacteria 14481
40 Ga0207694_10000056 3300025924 Bacteria 146908
41 Ga0207687_10000020 3300025927 Bacteria 228407
42 Ga0207687_10001900 3300025927 Bacteria 14372
43 Ga0207706_10000017 3300025933 Bacteria 169589
44 Ga0207686_10000199 3300025934 Bacteria 46373
45 Ga0207670_10056756 3300025936 Bacteria 2653
46 Ga0207669_10000131 3300025937 Bacteria 37319
47 Ga0207661_10067537 3300025944 Bacteria 2908
48 Ga0207679_10020749 3300025945 Bacteria 4440
49 Ga0207651_10000664 3300025960 Bacteria 14678
50 Ga0207677_10001178 3300026023 Bacteria 14220
51 Ga0207703_10000166 3300026035 Bacteria 76553
52 Ga0207639_10210063 3300026041 Bacteria 1675
53 Ga0207678_10105781 3300026067 Bacteria 2401
54 Ga0207702_10004436 3300026078 Bacteria 12465
55 Ga0207648_10001799 3300026089 Bacteria 23490
56 Ga0268266_10000045 3300028379 Bacteria 312955
57 Ga0265337_1000805 3300028556 Bacteria 16508
58 Ga0265326_10000084 3300028558 Bacteria 50129
59 Ga0265322_10000198 3300028654 Bacteria 26588
60 Ga0265324_10023816 3300029957 Bacteria 2178
61 Ga0265332_10037936 3300031238 Bacteria 2089
62 Ga0265328_10017656 3300031239 Bacteria 2761
63 Ga0265320_10000035 3300031240 Bacteria 137855
64 Ga0265329_10019214 3300031242 Bacteria 2323
65 Ga0265331_10023158 3300031250 Bacteria 3160
66 Ga0265327_10000015 3300031251 Bacteria 496677
67 Ga0265316_10027343 3300031344 Bacteria 4725
68 Ga0265313_10109429 3300031595 Bacteria 1216
69 Ga0265314_10000690 3300031711 Bacteria 40955
70 Ga0265342_10118561 3300031712 Bacteria 1492
71 Ga0373955_0028899 3300035172 Bacteria 2879
72 Ga0373937_0007200 3300036401 Bacteria 9627
73 Ga0373937_0285134 3300036401 Bacteria 1560
74 Ga0451853_1338654 3300041512 Bacteria 1858
75 Ga0466963_0000022 3300044694 Bacteria 52600
76 Ga0466963_0066096 3300044694 Bacteria 2425
77 Ga0466963_0106532 3300044694 Bacteria 1922
78 Ga0466971_0012532 3300044719 Bacteria 3718
79 Ga0466960_0000033 3300044901 Bacteria 46153
80 Ga0466960_0057097 3300044901 Bacteria 1902
81 Ga0466967_0326441 3300045976 Bacteria 1481
82 Ga0495592_0000912 3300046454 Bacteria 20489
83 Ga0495629_0022340 3300046459 Bacteria 4511
84 Ga0495638_0093251 3300046460 Bacteria 1811
85 Ga0495651_0138823 3300046462 Bacteria 1765
86 Ga0495653_0033150 3300046463 Bacteria 4094
87 Ga0495650_0000398 3300046471 Bacteria 72672
88 Ga0495582_0000001 3300046473 Bacteria 252434
89 Ga0495662_0000133 3300046476 Bacteria 28271
90 Ga0495594_0125555 3300046499 Bacteria 1452
91 Ga0495608_0003019 3300046511 Bacteria 12014
92 Ga0495608_0037719 3300046511 Bacteria 3249
93 Ga0495620_0002158 3300046515 Bacteria 11431
94 Ga0495628_0022200 3300046516 Bacteria 5216
95 Ga0495628_0078105 3300046516 Bacteria 2574
96 Ga0495628_0154434 3300046516 Bacteria 1747
97 Ga0495630_0000012 3300046517 Bacteria 223330
98 Ga0495630_0003163 3300046517 Bacteria 11429
99 Ga0495630_0064844 3300046517 Bacteria 2745
100 Ga0495652_0004585 3300046529 Bacteria 13174
101 Ga0495640_0007812 3300046533 Bacteria 8414
102 Ga0495587_0074999 3300046536 Bacteria 1964
103 Ga0495621_0001449 3300046539 Bacteria 6146
104 Ga0495645_0032740 3300046543 Bacteria 3792
105 Ga0495645_0073531 3300046543 Bacteria 2462
106 Ga0495645_0103932 3300046543 Bacteria 2018
107 Ga0495656_0000295 3300046615 Bacteria 17274
108 Ga0495634_0010503 3300046642 Bacteria 6783
109 Ga0495657_0006985 3300046675 Bacteria 8756
110 Ga0495657_0155255 3300046675 Bacteria 1419
111 Ga0495647_0000043 3300046681 Bacteria 36874
112 Ga0495658_0000193 3300046683 Bacteria 35142
113 Ga0495669_0000102 3300046684 Bacteria 53777
114 Ga0495613_0000282 3300046689 Bacteria 47001
115 Ga0495613_0030444 3300046689 Bacteria 4009
116 Ga0495613_0074173 3300046689 Bacteria 2478
117 Ga0495613_0111304 3300046689 Bacteria 1972
118 Ga0495613_0162278 3300046689 Bacteria 1589
119 Ga0495624_0006535 3300046690 Bacteria 8263
120 Ga0495600_0001288 3300046809 Bacteria 13857
121 Ga0495600_0299081 3300046809 Bacteria 1015
122 Ga0495604_0000267 3300047317 Bacteria 46398
123 Ga0495604_0028724 3300047317 Bacteria 4425
124 Ga0495676_0001626 3300047321 Bacteria 19533
125 Ga0495676_0010974 3300047321 Bacteria 8192
126 Ga0495676_0018201 3300047321 Bacteria 6197
127 Ga0495680_0000193 3300047322 Bacteria 65567
128 Ga0495680_0005500 3300047322 Bacteria 11903
129 Ga0495679_023349 3300047446 Bacteria 2099
130 Ga0496100_0000005 3300048903 Bacteria 312112
131 Ga0496100_0000014 3300048903 Bacteria 174991
132 Ga0496101_0000036 3300048904 Bacteria 175595
133 Ga0496101_0000493 3300048904 Bacteria 24897
134 Ga0496104_0000024 3300048907 Bacteria 229913
135 Ga0496105_0000013 3300048908 Bacteria 229894
136 Ga0496106_0000043 3300048909 Bacteria 105477
137 Ga0496106_0000193 3300048909 Bacteria 42951
138 Ga0496106_0001892 3300048909 Bacteria 15675
139 Ga0496107_0000094 3300048910 Bacteria 42797
140 Ga0496107_0000271 3300048910 Bacteria 27463
141 Ga0496108_0001109 3300048911 Bacteria 21079
142 Ga0496108_0051885 3300048911 Bacteria 3436
143 Ga0496109_0000004 3300048912 Bacteria 404818
144 Ga0496109_0001414 3300048912 Bacteria 19912
145 Ga0496110_0185063 3300048913 Bacteria 1891
146 Ga0496113_0099741 3300048916 Bacteria 2249
147 Ga0496113_0245217 3300048916 Bacteria 1430
148 Ga0496114_0018100 3300048917 Bacteria 5693
149 Ga0496115_0000010 3300048918 Bacteria 227112
150 Ga0496115_0001569 3300048918 Bacteria 16428
151 Ga0496119_0000055 3300048922 Bacteria 180121
152 Ga0496125_0052525 3300048928 Bacteria 3351
153 Ga0501034_0019495 3300049571 Bacteria 6937
154 Ga0501034_0228135 3300049571 Bacteria 1812
155 Ga0501047_0046520 3300049581 Bacteria 4194
156 Ga0501075_0003224 3300049591 Bacteria 10913
157 Ga0501081_0066390 3300049743 Bacteria 2509
158 Ga0501044_0015577 3300049823 Bacteria 8192
159 nmdc:mga0yw44_33607_c1 3300050492 Bacteria 2998
160 nmdc:mga0yw44_94602_c1 3300050492 Bacteria 1894
161 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
162 Ga0495601_0000156 3300053077 Bacteria 38350
163 Ga0495612_0003529 3300053078 Bacteria 6484
164 Ga0495655_0000023 3300053083 Bacteria 39507
165 Ga0495595_0000200 3300053084 Bacteria 24133
166 Ga0495595_0023189 3300053084 Bacteria 2730
167 Ga0495619_0000602 3300053085 Bacteria 23838
168 Ga0495619_0002992 3300053085 Bacteria 10976
169 Ga0495619_0003076 3300053085 Bacteria 10833
170 Ga0495619_0025796 3300053085 Bacteria 3777
171 Ga0500628_000001 3300053129 Bacteria 564074
172 Ga0495670_0033773
173 JGI24034J26672_10000377
174 Ga0068868_100000633
175 Ga0070691_10009524
176 Ga0070691_10027617
177 Ga0070674_100000004
178 Ga0070673_100000474
179 Ga0070714_100186178
180 Ga0070663_100125718
181 Ga0070662_100000006
182 Ga0070681_10003891
183 Ga0068867_100002668
184 Ga0070679_100000844
185 Ga0070665_100000040
186 Ga0070664_100038179
187 Ga0068866_10000004
188 Ga0068858_100001009
189 Ga0068860_100118890
190 Ga0075365_10030559
191 Ga0075365_10092060
192 Ga0075364_10054857
193 Ga0070715_10000014
194 Ga0097621_100116678
195 Ga0068871_100340113
196 Ga0075433_10000244
197 Ga0105240_10337301
198 Ga0105245_10071389
199 Ga0105238_10000048
200 Ga0105249_10059376
201 Ga0157374_10001900
202 Ga0157375_10008154
203 Ga0157380_10000507
204 Ga0157379_10014841
205 Ga0163161_10000160
206 Ga0207682_10000140
207 Ga0207642_10000005
208 Ga0207685_10000025
209 Ga0207695_10254870
210 Ga0207663_10000748
211 Ga0207694_10000056
212 Ga0207687_10000020
213 Ga0207687_10001900
214 Ga0207706_10000017
215 Ga0207686_10000199
216 Ga0207670_10056756
217 Ga0207669_10000131
218 Ga0207661_10067537
219 Ga0207679_10020749
220 Ga0207651_10000664
221 Ga0207677_10001178
222 Ga0207703_10000166
223 Ga0207639_10210063
224 Ga0207678_10105781
225 Ga0207702_10004436
226 Ga0207648_10001799
227 Ga0268266_10000045
228 Ga0265337_1000805
229 Ga0265326_10000084
230 Ga0265322_10000198
231 Ga0265324_10023816
232 Ga0265332_10037936
233 Ga0265328_10017656
234 Ga0265320_10000035
235 Ga0265329_10019214
236 Ga0265331_10023158
237 Ga0265327_10000015
238 Ga0265316_10027343
239 Ga0265313_10109429
240 Ga0265314_10000690
241 Ga0265342_10118561
242 Ga0373955_0028899
243 Ga0373937_0007200
244 Ga0373937_0285134
245 Ga0451853_1338654
246 Ga0466963_0000022
247 Ga0466963_0066096
248 Ga0466963_0106532
249 Ga0466971_0012532
250 Ga0466960_0000033
251 Ga0466960_0057097
252 Ga0466967_0326441
253 Ga0495592_0000912
254 Ga0495629_0022340
255 Ga0495638_0093251
256 Ga0495651_0138823
257 Ga0495653_0033150
258 Ga0495650_0000398
259 Ga0495582_0000001
260 Ga0495662_0000133
261 Ga0495594_0125555
262 Ga0495608_0003019
263 Ga0495608_0037719
264 Ga0495620_0002158
265 Ga0495628_0022200
266 Ga0495628_0078105
267 Ga0495628_0154434
268 Ga0495630_0000012
269 Ga0495630_0003163
270 Ga0495630_0064844
271 Ga0495652_0004585
272 Ga0495640_0007812
273 Ga0495587_0074999
274 Ga0495621_0001449
275 Ga0495645_0032740
276 Ga0495645_0073531
277 Ga0495645_0103932
278 Ga0495656_0000295
279 Ga0495634_0010503
280 Ga0495657_0006985
281 Ga0495657_0155255
282 Ga0495647_0000043
283 Ga0495658_0000193
284 Ga0495669_0000102
285 Ga0495613_0000282
286 Ga0495613_0030444
287 Ga0495613_0074173
288 Ga0495613_0111304
289 Ga0495613_0162278
290 Ga0495624_0006535
291 Ga0495600_0001288
292 Ga0495600_0299081
293 Ga0495604_0000267
294 Ga0495604_0028724
295 Ga0495676_0001626
296 Ga0495676_0010974
297 Ga0495676_0018201
298 Ga0495680_0000193
299 Ga0495680_0005500
300 Ga0495679_023349
301 Ga0496100_0000005
302 Ga0496100_0000014
303 Ga0496101_0000036
304 Ga0496101_0000493
305 Ga0496104_0000024
306 Ga0496105_0000013
307 Ga0496106_0000043
308 Ga0496106_0000193
309 Ga0496106_0001892
310 Ga0496107_0000094
311 Ga0496107_0000271
312 Ga0496108_0001109
313 Ga0496108_0051885
314 Ga0496109_0000004
315 Ga0496109_0001414
316 Ga0496110_0185063
317 Ga0496113_0099741
318 Ga0496113_0245217
319 Ga0496114_0018100
320 Ga0496115_0000010
321 Ga0496115_0001569
322 Ga0496119_0000055
323 Ga0496125_0052525
324 Ga0501034_0019495
325 Ga0501034_0228135
326 Ga0501047_0046520
327 Ga0501075_0003224
328 Ga0501081_0066390
329 Ga0501044_0015577
330 nmdc:mga0yw44_33607_c1
331 nmdc:mga0yw44_94602_c1
332 nmdc:mga0a205_45_c1
333 Ga0495601_0000156
334 Ga0495612_0003529
335 Ga0495655_0000023
336 Ga0495595_0000200
337 Ga0495595_0023189
338 Ga0495619_0000602
339 Ga0495619_0002992
340 Ga0495619_0003076
341 Ga0495619_0025796
342 Ga0500628_000001

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

110

301

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9706 7 372
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9703 7 372
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9628 7 372
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9599 7 372
3ffr-assembly1.cif.gz_A-2 crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution 0.8889 23 371
ID Description Score Start End Superfamily
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.976 30 266 3.20.10.10
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.964 30 266 3.20.10.10
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9585 270 372 3.90.1150.10
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9322 270 372 3.90.1150.10
3ffrA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8749 30 264 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6B3FJM8-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9842 50 203 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A2S9FBJ7-F1-model_v4 phosphoserine transaminase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) 0.9831 49 373 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0008615
GO:0019265
AF-A0A7G1I7M0-F1-model_v4 Aminotransferase class V domain-containing protein 0.9817 99 197
AF-A0A7W1KBB2-F1-model_v4 Phosphoserine transaminase (EC 2.6.1.52) 0.9814 92 372 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0008615
GO:0019265
AF-A0A6J6HXD8-F1-model_v4 Unannotated protein 0.9792 77 373 GO:0004648
GO:0004760
GO:0005777
GO:0006564
GO:0008453
GO:0019265

Map