F259705

General Info

Members Datasets Scaffolds Average Seq Length
171 114 127 401

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2523231044|2523384767
Length 437
Sequence DIPEYAHLSESDVEALGAELDAIRAEIEADRGERDARYIRNTIRFQRGMELAGRALIFGSSKRSMWWAGAGALGIAKIVENMELGHNVMHGQWDWMNDPEVHSTTWEWDNTDPSAHWKHTHNYIHHKYTNVLGMDDDVGYGLLRVTRDQRWRPFYLGNLAYNTLLALFFEWGVAAQHLELGKKRRTPEAKEQFRRDLSDVGRKIGKQVAKDYVVYPAVVSAATGRRVGFGRAFGKAATANATANIIRNVWTNAVIFCGHFPDGAEKFTKQDVDGETQAEWYLRQMLGSANFRSGPVLGFMSGNLSYQIEHHIYPDLPSNRLPEISVRVRALCEKYDLPYTTGPLPVQYAKAWRTIAKLSLPDKYLKATTDDAPETASERRFKDGLPEDLRLQSTVDPMTGRRRGLRSAIKSLREGSGLLRRRVRPAEASTPVARRAA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2643221641 Nocardioides sp. Root122 Isolate Unclassified
7 2643221692 Nocardia sp. Root136 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
12 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
13 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
14 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
15 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
16 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
19 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
20 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
21 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
22 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
23 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
24 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
25 2922554459 Rhodococcus sp. 66b Isolate Unclassified
26 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
27 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
28 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
29 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
30 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
75 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.68
Metatranscriptomes 2.34
Isolates 23.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 7.02
Rhizosphere 54.97
Stem 0
Stem Tuber 0
Unclassified 23.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016617 3300001989 Bacteria 2662
2 JGI24735J21928_10001077 3300002067 Bacteria 9786
3 Ga0006562J51391_1026460 3300003578 Bacteria 1377
4 Ga0070658_10074344 3300005327 Bacteria 2787
5 Ga0070709_10027678 3300005434 Bacteria 3373
6 Ga0070714_100047290 3300005435 Bacteria 3654
7 Ga0070714_100235217 3300005435 Bacteria 1689
8 Ga0070708_100185996 3300005445 Bacteria 1942
9 Ga0070706_100109191 3300005467 Bacteria 2574
10 Ga0070706_100148976 3300005467 Bacteria 2185
11 Ga0070665_100126223 3300005548 Bacteria 2561
12 Ga0075365_10014668 3300006038 Bacteria 4720
13 Ga0075368_10002389 3300006042 Bacteria 6114
14 Ga0075363_100090399 3300006048 Bacteria 1684
15 Ga0075364_10036910 3300006051 Bacteria 3161
16 Ga0075364_10078071 3300006051 Bacteria 2186
17 Ga0075364_10090149 3300006051 Bacteria 2033
18 Ga0075367_10005848 3300006178 Bacteria 6161
19 Ga0075369_10001514 3300006186 Bacteria 7947
20 Ga0075369_10021105 3300006186 Bacteria 2672
21 Ga0075370_10013666 3300006353 Bacteria 4321
22 Ga0075370_10026739 3300006353 Bacteria 3198
23 Ga0075370_10035760 3300006353 Bacteria 2789
24 Ga0075370_10041153 3300006353 Bacteria 2608
25 Ga0105243_10000724 3300009148 Bacteria 31687
26 Ga0157369_10141490 3300013105 Bacteria 2546
27 Ga0183368_1004 3300015687 Bacteria 1211761
28 Ga0206353_11297550 3300020082 Bacteria 2588
29 Ga0213876_10000924 3300021384 Bacteria 19415
30 Ga0213876_10009017 3300021384 Bacteria 5373
31 Ga0213876_10024443 3300021384 Bacteria 3189
32 Ga0207647_10032410 3300025904 Bacteria 3357
33 Ga0207646_10018597 3300025922 Bacteria 6479
34 Ga0207664_10061422 3300025929 Bacteria 2998
35 Ga0207709_10000795 3300025935 Bacteria 24561
36 Ga0209813_10008107 3300027866 Bacteria 2643
37 Ga0268264_10226969 3300028381 Bacteria 1722
38 Ga0265327_10000019 3300031251 Bacteria 427653
39 Ga0265327_10000177 3300031251 Bacteria 136559
40 Ga0265327_10000610 3300031251 Bacteria 59085
41 Ga0265327_10001133 3300031251 Bacteria 36601
42 Ga0265327_10010352 3300031251 Bacteria 6571
43 Ga0436364_0294604 3300037853 Bacteria 2918
44 Ga0436364_1032328 3300037853 Bacteria 5613
45 Ga0436364_1349169 3300037853 Bacteria 19659
46 Ga0436365_0218176 3300039437 Bacteria 31043
47 Ga0436365_1785098 3300039437 Bacteria 11567
48 Ga0436363_0567208 3300039450 Bacteria 5093
49 Ga0466972_0018463 3300044658 Bacteria 3486
50 Ga0466965_0003666 3300044683 Bacteria 6776
51 Ga0466965_0004916 3300044683 Bacteria 5975
52 Ga0466966_0000760 3300044684 Bacteria 20479
53 Ga0466966_0017706 3300044684 Bacteria 4705
54 Ga0466963_0089873 3300044694 Bacteria 2090
55 Ga0466971_0009989 3300044719 Bacteria 4146
56 Ga0466968_0022156 3300044735 Bacteria 2580
57 Ga0466970_0061559 3300044765 Bacteria 2011
58 Ga0466957_0007840 3300044842 Bacteria 6052
59 Ga0466957_0012948 3300044842 Bacteria 4832
60 Ga0466960_0000416 3300044901 Bacteria 14698
61 Ga0466960_0001169 3300044901 Bacteria 9439
62 Ga0466960_0024967 3300044901 Bacteria 2700
63 Ga0466959_0012695 3300045049 Bacteria 6094
64 Ga0466959_0015332 3300045049 Bacteria 5580
65 Ga0466958_0010634 3300045836 Bacteria 5160
66 Ga0466958_0014588 3300045836 Bacteria 4486
67 Ga0466958_0055926 3300045836 Bacteria 2396
68 Ga0466967_0111687 3300045976 Bacteria 2512
69 Ga0495665_0007461 3300046531 Bacteria 5916
70 Ga0495668_0000145 3300046616 Bacteria 106463
71 Ga0495588_0112194 3300046674 Bacteria 1436
72 Ga0495581_0054381 3300047315 Bacteria 2311
73 Ga0495581_0056440 3300047315 Bacteria 2267
74 Ga0495581_0083492 3300047315 Bacteria 1850
75 Ga0495685_059984 3300047447 Bacteria 1283
76 Ga0496100_0047857 3300048903 Bacteria 2758
77 Ga0496101_0049750 3300048904 Bacteria 3016
78 Ga0496102_0178554 3300048905 Bacteria 2000
79 Ga0496103_0109744 3300048906 Bacteria 1752
80 Ga0496109_0000598 3300048912 Bacteria 30223
81 Ga0496109_0037191 3300048912 Bacteria 4398
82 Ga0496109_0065252 3300048912 Bacteria 3333
83 Ga0496110_0015171 3300048913 Bacteria 6408
84 Ga0496112_0116555 3300048915 Bacteria 2641
85 Ga0496113_0006488 3300048916 Bacteria 7423
86 Ga0496115_0000116 3300048918 Bacteria 73024
87 Ga0496115_0106829 3300048918 Bacteria 2298
88 Ga0496117_0039440 3300048920 Bacteria 3486
89 Ga0496118_0000536 3300048921 Bacteria 62442
90 Ga0496122_0003006 3300048925 Bacteria 22920
91 Ga0496122_0005578 3300048925 Bacteria 14897
92 Ga0496123_0002306 3300048926 Bacteria 23967
93 Ga0496123_0010854 3300048926 Bacteria 7982
94 Ga0496125_0053291 3300048928 Bacteria 3317
95 Ga0496126_0021531 3300048929 Bacteria 6295
96 Ga0501323_000754 3300049539 Bacteria 2571
97 Ga0501324_001966 3300049540 Bacteria 1443
98 Ga0501031_0081479 3300049568 Bacteria 2110
99 Ga0501032_0003250 3300049569 Bacteria 12500
100 Ga0501032_0030198 3300049569 Bacteria 3718
101 Ga0501032_0132698 3300049569 Bacteria 1642
102 Ga0501034_0001896 3300049571 Bacteria 26499
103 Ga0501034_0023883 3300049571 Bacteria 6224
104 Ga0501036_0014220 3300049572 Bacteria 6622
105 Ga0501036_0123226 3300049572 Bacteria 2189
106 Ga0501037_0002327 3300049573 Bacteria 13728
107 Ga0501038_0018832 3300049574 Bacteria 6232
108 Ga0501039_0003757 3300049575 Bacteria 11409
109 Ga0501039_0033845 3300049575 Bacteria 3942
110 Ga0501043_0000485 3300049579 Bacteria 35592
111 Ga0501070_0000400 3300049586 Bacteria 39598
112 Ga0501070_0024548 3300049586 Bacteria 5056
113 Ga0501070_0141241 3300049586 Bacteria 1988
114 Ga0501071_0088961 3300049587 Bacteria 2266
115 Ga0501035_0009107 3300049822 Bacteria 9231
116 Ga0501044_0000400 3300049823 Bacteria 53515
117 Ga0501044_0033185 3300049823 Bacteria 5426
118 nmdc:mga00v17_466_c1 3300050491 Bacteria 22660
119 nmdc:mga00v17_59519_c1 3300050491 Bacteria 2344
120 nmdc:mga0yw44_115725_c1 3300050492 Bacteria 1723
121 nmdc:mga0yw44_67449_c1 3300050492 Bacteria 2211
122 nmdc:mga04h51_1828_c1 3300050495 Bacteria 4975
123 nmdc:mga07m45_88429_c1 3300050496 Bacteria 1773
124 nmdc:mga0sz30_219_c1 3300050516 Bacteria 21835
125 nmdc:mga0sz30_30813_c1 3300050516 Bacteria 2218
126 Ga0495619_0086106 3300053085 Bacteria 2123
127 Ga0500650_0083366 3300053098 Bacteria 1495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0000598 Ga0496109_0000598_2461_3900 328
2 3300006051 Ga0075364_10090149 Ga0075364_100901492 336
3 3300050492 nmdc:mga0yw44_115725_c1 nmdc:mga0yw44_115725_c1_343_1566 336
4 3300044658 Ga0466972_0018463 Ga0466972_0018463_458_1705 337
5 3300044683 Ga0466965_0004916 Ga0466965_0004916_4501_5748 337
6 3300044735 Ga0466968_0022156 Ga0466968_0022156_529_1776 337
7 3300044842 Ga0466957_0007840 Ga0466957_0007840_286_1533 337
8 3300044901 Ga0466960_0024967 Ga0466960_0024967_1265_2512 337
9 3300045976 Ga0466967_0111687 Ga0466967_0111687_351_1589 337
10 iso_pu_bacteria 2887630918 2887631141 337
11 3300021384 Ga0213876_10024443 Ga0213876_100244432 339
12 3300039437 Ga0436365_1785098 Ga0436365_1785098_3959_5263 339
13 3300031251 Ga0265327_10000019 Ga0265327_1000001910 345
14 3300049586 Ga0501070_0141241 Ga0501070_0141241_581_1771 345
15 3300006038 Ga0075365_10014668 Ga0075365_100146682 346
16 3300050492 nmdc:mga0yw44_67449_c1 nmdc:mga0yw44_67449_c1_444_1571 346
17 3300031251 Ga0265327_10000019 Ga0265327_1000001911 348
18 3300048920 Ga0496117_0039440 Ga0496117_0039440_1120_2400 348
19 3300048921 Ga0496118_0000536 Ga0496118_0000536_32965_34245 348
20 3300049568 Ga0501031_0081479 Ga0501031_0081479_771_1946 348
21 3300049569 Ga0501032_0003250 Ga0501032_0003250_8146_9417 348
22 3300049569 Ga0501032_0132698 Ga0501032_0132698_32_1207 348
23 3300049571 Ga0501034_0001896 Ga0501034_0001896_23118_24389 348
24 3300049572 Ga0501036_0014220 Ga0501036_0014220_1800_3071 348
25 3300049572 Ga0501036_0123226 Ga0501036_0123226_855_2030 348
26 3300049573 Ga0501037_0002327 Ga0501037_0002327_3252_4523 348
27 3300049574 Ga0501038_0018832 Ga0501038_0018832_3895_5166 348
28 3300049575 Ga0501039_0003757 Ga0501039_0003757_6372_7643 348
29 3300049575 Ga0501039_0033845 Ga0501039_0033845_1545_2720 348
30 3300049579 Ga0501043_0000485 Ga0501043_0000485_9302_10573 348
31 3300049586 Ga0501070_0000400 Ga0501070_0000400_28278_29549 348
32 3300049587 Ga0501071_0088961 Ga0501071_0088961_761_1936 348
33 3300049823 Ga0501044_0033185 Ga0501044_0033185_1052_2323 348
34 3300053098 Ga0500650_0083366 Ga0500650_0083366_147_1382 348
35 3300006186 Ga0075369_10001514 Ga0075369_100015148 349
36 3300048903 Ga0496100_0047857 Ga0496100_0047857_1030_2277 349
37 3300048904 Ga0496101_0049750 Ga0496101_0049750_1155_2402 349
38 3300048916 Ga0496113_0006488 Ga0496113_0006488_6114_7361 349
39 3300048925 Ga0496122_0005578 Ga0496122_0005578_13479_14726 349
40 3300048926 Ga0496123_0010854 Ga0496123_0010854_6280_7527 349
41 3300048929 Ga0496126_0021531 Ga0496126_0021531_4979_6226 349
42 3300050516 nmdc:mga0sz30_219_c1 nmdc:mga0sz30_219_c1_14230_15525 349
43 3300006048 Ga0075363_100090399 Ga0075363_1000903992 350
44 3300006353 Ga0075370_10026739 Ga0075370_100267393 350
45 3300044683 Ga0466965_0003666 Ga0466965_0003666_198_1445 350
46 3300044719 Ga0466971_0009989 Ga0466971_0009989_1289_2584 350
47 3300044901 Ga0466960_0000416 Ga0466960_0000416_149_1396 350
48 3300046616 Ga0495668_0000145 Ga0495668_0000145_47457_48719 350
49 3300047315 Ga0495581_0054381 Ga0495581_0054381_393_1601 350
50 3300048928 Ga0496125_0053291 Ga0496125_0053291_626_1888 350
51 3300049571 Ga0501034_0023883 Ga0501034_0023883_2814_4109 350
52 3300049822 Ga0501035_0009107 Ga0501035_0009107_6985_8280 350
53 3300049823 Ga0501044_0000400 Ga0501044_0000400_12523_13818 350
54 3300005434 Ga0070709_10027678 Ga0070709_100276783 351
55 3300005435 Ga0070714_100047290 Ga0070714_1000472904 351
56 3300005445 Ga0070708_100185996 Ga0070708_1001859962 351
57 3300005467 Ga0070706_100148976 Ga0070706_1001489762 351
58 3300013105 Ga0157369_10141490 Ga0157369_101414902 351
59 3300025922 Ga0207646_10018597 Ga0207646_100185974 351
60 3300037853 Ga0436364_1349169 Ga0436364_1349169_2197_3447 351
61 3300039450 Ga0436363_0567208 Ga0436363_0567208_292_1554 351
62 3300044684 Ga0466966_0017706 Ga0466966_0017706_1252_2526 351
63 3300044765 Ga0466970_0061559 Ga0466970_0061559_21_1295 351
64 3300045049 Ga0466959_0015332 Ga0466959_0015332_2578_3852 351
65 3300045836 Ga0466958_0014588 Ga0466958_0014588_1968_3242 351
66 3300047315 Ga0495581_0083492 Ga0495581_0083492_10_1248 351
67 3300048925 Ga0496122_0003006 Ga0496122_0003006_5862_7136 351
68 3300048926 Ga0496123_0002306 Ga0496123_0002306_16818_18092 351
69 iso_pu_bacteria 2582581314 2585313125 351
70 3300006042 Ga0075368_10002389 Ga0075368_100023894 353
71 3300006178 Ga0075367_10005848 Ga0075367_100058485 353
72 3300006186 Ga0075369_10021105 Ga0075369_100211052 353
73 3300006353 Ga0075370_10013666 Ga0075370_100136664 353
74 3300021384 Ga0213876_10009017 Ga0213876_100090174 353
75 3300027866 Ga0209813_10008107 Ga0209813_100081072 353
76 3300037853 Ga0436364_0294604 Ga0436364_0294604_1413_2714 353
77 3300039437 Ga0436365_0218176 Ga0436365_0218176_19121_20422 353
78 3300044694 Ga0466963_0089873 Ga0466963_0089873_645_1922 353
79 3300047447 Ga0495685_059984 Ga0495685_059984_31_1125 353
80 3300050491 nmdc:mga00v17_466_c1 nmdc:mga00v17_466_c1_20436_21713 353
81 3300050495 nmdc:mga04h51_1828_c1 nmdc:mga04h51_1828_c1_1119_2228 353
82 3300050516 nmdc:mga0sz30_30813_c1 nmdc:mga0sz30_30813_c1_834_2111 353
83 3300005467 Ga0070706_100109191 Ga0070706_1001091912 354
84 3300006353 Ga0075370_10035760 Ga0075370_100357601 354
85 3300009148 Ga0105243_10000724 Ga0105243_1000072416 354
86 3300025935 Ga0207709_10000795 Ga0207709_1000079512 354
87 3300044684 Ga0466966_0000760 Ga0466966_0000760_1055_2341 354
88 3300044842 Ga0466957_0012948 Ga0466957_0012948_298_1584 354
89 3300045049 Ga0466959_0012695 Ga0466959_0012695_619_1905 354
90 3300045836 Ga0466958_0010634 Ga0466958_0010634_232_1518 354
91 3300046674 Ga0495588_0112194 Ga0495588_0112194_174_1409 354
92 3300050496 nmdc:mga07m45_88429_c1 nmdc:mga07m45_88429_c1_264_1499 354
93 iso_pu_bacteria 2643221641 2644230826 354
94 3300006051 Ga0075364_10036910 Ga0075364_100369102 357
95 3300047315 Ga0495581_0056440 Ga0495581_0056440_90_1298 357
96 3300050491 nmdc:mga00v17_59519_c1 nmdc:mga00v17_59519_c1_364_1647 357
97 3300028381 Ga0268264_10226969 Ga0268264_102269691 361
98 3300048912 Ga0496109_0037191 Ga0496109_0037191_1729_2979 363
99 3300049586 Ga0501070_0024548 Ga0501070_0024548_2672_3790 363
100 iso_pu_bacteria 2523231044 2523383726 363
101 iso_pu_bacteria 2523231044 2523384766 363
102 iso_pu_bacteria 2523231044 2523384767 363
103 iso_pu_bacteria 2547132424 2548698565 363
104 iso_pu_bacteria 2551306166 2552110182 363
105 iso_pu_bacteria 2565956761 2566994198 363
106 iso_pu_bacteria 2565956761 2566994199 363
107 iso_pu_bacteria 2643221692 2644513536 363
108 iso_pu_bacteria 2738541308 2738887208 363
109 iso_pu_bacteria 2738541308 2738887209 363
110 iso_pu_bacteria 2738543005 2739203027 363
111 iso_pu_bacteria 2738543011 2739236598 363
112 iso_pu_bacteria 2738543034 2739366994 363
113 iso_pu_bacteria 2744054611 2744954252 363
114 iso_pu_bacteria 2744054611 2744954379 363
115 iso_pu_bacteria 2751185725 2753034845 363
116 iso_pu_bacteria 2751185725 2753035585 363
117 iso_pu_bacteria 2751185725 2753035586 363
118 iso_pu_bacteria 2751185792 2753323362 363
119 iso_pu_bacteria 2751185792 2753326388 363
120 iso_pu_bacteria 2842888712 2842892155 363
121 iso_pu_bacteria 2889300758 2889306084 363
122 iso_pu_bacteria 2904535858 2904538701 363
123 iso_pu_bacteria 2904535858 2904538702 363
124 iso_pu_bacteria 2904765812 2904765914 363
125 iso_pu_bacteria 2904770941 2904773595 363
126 iso_pu_bacteria 2908811453 2908814887 363
127 iso_pu_bacteria 2919420072 2919424195 363
128 iso_pu_bacteria 2919432681 2919437221 363
129 iso_pu_bacteria 2919713450 2919715402 363
130 iso_pu_bacteria 2919713450 2919717230 363
131 iso_pu_bacteria 2922554459 2922559429 363
132 iso_pu_bacteria 2922554459 2922559430 363
133 iso_pu_bacteria 2928142448 2928142741 363
134 iso_pu_bacteria 2939743619 2939744214 363
135 iso_pu_bacteria 2974315732 2974317942 363
136 iso_pu_bacteria 2984523437 2984526159 363
137 3300005548 Ga0070665_100126223 Ga0070665_1001262233 364
138 3300048913 Ga0496110_0015171 Ga0496110_0015171_5024_6145 364
139 3300048918 Ga0496115_0106829 Ga0496115_0106829_1059_2180 364
140 iso_pu_bacteria 2932398195 2932401441 364
141 3300003578 Ga0006562J51391_1026460 Ga0006562J51391_10264601 365
142 3300005327 Ga0070658_10074344 Ga0070658_100743442 365
143 3300005435 Ga0070714_100235217 Ga0070714_1002352172 365
144 3300006051 Ga0075364_10078071 Ga0075364_100780712 365
145 3300006353 Ga0075370_10026739 Ga0075370_100267392 365
146 3300006353 Ga0075370_10041153 Ga0075370_100411532 365
147 3300020082 Ga0206353_11297550 Ga0206353_112975502 365
148 3300021384 Ga0213876_10000924 Ga0213876_100009247 365
149 3300025929 Ga0207664_10061422 Ga0207664_100614222 365
150 3300031251 Ga0265327_10000177 Ga0265327_1000017739 365
151 3300031251 Ga0265327_10000610 Ga0265327_1000061047 365
152 3300031251 Ga0265327_10001133 Ga0265327_1000113311 365
153 3300031251 Ga0265327_10010352 Ga0265327_100103524 365
154 3300037853 Ga0436364_1032328 Ga0436364_1032328_3843_5129 365
155 3300044901 Ga0466960_0001169 Ga0466960_0001169_640_1932 365
156 3300045836 Ga0466958_0055926 Ga0466958_0055926_127_1368 365
157 3300046531 Ga0495665_0007461 Ga0495665_0007461_1101_2357 365
158 3300046616 Ga0495668_0000145 Ga0495668_0000145_46077_47318 365
159 3300048905 Ga0496102_0178554 Ga0496102_0178554_678_1868 365
160 3300048906 Ga0496103_0109744 Ga0496103_0109744_15_1481 365
161 3300048912 Ga0496109_0065252 Ga0496109_0065252_85_1275 365
162 3300048915 Ga0496112_0116555 Ga0496112_0116555_698_1942 365
163 3300049539 Ga0501323_000754 Ga0501323_000754_342_1580 365
164 3300049540 Ga0501324_001966 Ga0501324_001966_54_1292 365
165 3300049569 Ga0501032_0030198 Ga0501032_0030198_185_1477 365
166 3300053085 Ga0495619_0086106 Ga0495619_0086106_221_1411 365
167 3300001989 JGI24739J22299_10016617 JGI24739J22299_100166173 375
168 3300002067 JGI24735J21928_10001077 JGI24735J21928_100010774 375
169 3300015687 Ga0183368_1004 Ga0183368_1004705 375
170 3300025904 Ga0207647_10032410 Ga0207647_100324103 375
171 3300048918 Ga0496115_0000116 Ga0496115_0000116_66530_67657 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

64

343

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i4t-assembly2.cif.gz_A-2 crystal structure analysis of rac1-gmppnp in complex with arfaptin 0.2881 7 249
1i4t-assembly2.cif.gz_A-2 crystal structure analysis of rac1-gmppnp in complex with arfaptin 0.2853 7 249
8e0o-assembly1.cif.gz_A heterotrimeric variant of tctrp9, hetbgl03-15-18 0.2435 166 336
2nw7-assembly1.cif.gz_D crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferric heme. northeast structural genomics target xcr13 0.2397 9 337
2nw7-assembly1.cif.gz_D crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferric heme. northeast structural genomics target xcr13 0.2375 9 337
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5311 44 344 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5208 44 344 3.30.40.10
af_A0A0R4IM47_32_299_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.2939 12 258 1.20.1270.60
af_F1Q8Q4_145_353_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.2896 12 254 1.20.1270.60
af_F1Q8Q4_145_353_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.2803 12 254 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A2A5BTZ1-F1-model_v4 Acyl-CoA desaturase 0.9878 5 364 GO:0006629
GO:0016020
GO:0016717
AF-A0A847HCB0-F1-model_v4 Acyl-CoA desaturase 0.9838 241 362 GO:0006629
GO:0016020
GO:0016717
AF-A0A0F6W0L2-F1-model_v4 Putative LINOLEOYL-CoA DESATURASE (DELTA(6)-DESATURASE) 0.9834 6 362 GO:0006629
GO:0016020
GO:0016717
AF-X8BHL8-F1-model_v4 deleted 0.9812 243 364
AF-A0A1G8HB28-F1-model_v4 Linoleoyl-CoA desaturase 0.9791 6 363 GO:0006629
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
90.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map