F260199

General Info

Members Datasets Scaffolds Average Seq Length
172 136 344 162

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100004446|Ga0070659_1000044463
Length 181
Sequence MAGATLIPFAGKAPRIAPDAFVAPGAVLIGDVEIGAEASIWYNCVLRGDVNRIRIGARTNIQDGSVLHVDSPHAGAEAGHPTLIGEEVLIGHLAMVHGCILHDRAFVGLGAIVMDGCEIESFGMLAAGALLTPGKRIPAGQLWAGRPAKYVRDLTQAERDANLAGVFHYVDLARAHRAALA

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
97 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
98 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
121 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
133 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
134 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
135 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
136 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 1.16
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.79
Nodule 0
Rhizoplane 0.58
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100004446 3300005366 Bacteria 10014
2 LJQas_1007027 3300000549 Bacteria 1390
3 JGI24739J22299_10074977 3300001989 Bacteria 1047
4 Ga0070658_10000033 3300005327 Bacteria 147380
5 Ga0070670_100017082 3300005331 Bacteria 6227
6 Ga0070670_100173139 3300005331 Bacteria 1873
7 Ga0070677_10000358 3300005333 Bacteria 15980
8 Ga0068868_100000001 3300005338 Bacteria 282170
9 Ga0070660_100001913 3300005339 Bacteria 14345
10 Ga0070660_100002218 3300005339 Bacteria 13388
11 Ga0070668_100000816 3300005347 Bacteria 21476
12 Ga0070669_100080611 3300005353 Bacteria 2423
13 Ga0070669_100154062 3300005353 Bacteria 1781
14 Ga0070675_100127905 3300005354 Bacteria 2163
15 Ga0070671_100000485 3300005355 Bacteria 27681
16 Ga0070671_100102714 3300005355 Bacteria 2399
17 Ga0070674_100194860 3300005356 Bacteria 1560
18 Ga0070673_100761468 3300005364 Bacteria 892
19 Ga0070659_100000001 3300005366 Bacteria 576390
20 Ga0070659_100003367 3300005366 Bacteria 11380
21 Ga0070667_100000035 3300005367 Bacteria 173461
22 Ga0070662_100344325 3300005457 Bacteria 1220
23 Ga0070684_101051150 3300005535 Bacteria 765
24 Ga0068853_100095802 3300005539 Bacteria 2617
25 Ga0068853_100120923 3300005539 Bacteria 2336
26 Ga0070672_100648727 3300005543 Bacteria 922
27 Ga0070672_100819349 3300005543 Bacteria 820
28 Ga0070686_100000387 3300005544 Bacteria 28114
29 Ga0070665_100000531 3300005548 Bacteria 53926
30 Ga0068854_100021862 3300005578 Bacteria 4348
31 Ga0068859_100111862 3300005617 Bacteria 2794
32 Ga0068864_100003840 3300005618 Bacteria 12386
33 Ga0068863_100007948 3300005841 Bacteria 10367
34 Ga0068863_100112864 3300005841 Bacteria 2588
35 Ga0068863_100223267 3300005841 Bacteria 1816
36 Ga0068863_100331828 3300005841 Bacteria 1479
37 Ga0068858_100001986 3300005842 Bacteria 20901
38 Ga0068860_100000106 3300005843 Bacteria 133556
39 Ga0068862_100001337 3300005844 Bacteria 22896
40 Ga0075364_10333766 3300006051 Bacteria 1033
41 Ga0075366_10067361 3300006195 Bacteria 2130
42 Ga0075430_100014947 3300006846 Bacteria 6610
43 Ga0075434_100058333 3300006871 Bacteria 3837
44 Ga0068865_101340536 3300006881 Bacteria 637
45 Ga0097620_100111869 3300006931 Bacteria 2794
46 Ga0097620_100265366 3300006931 Bacteria 1809
47 Ga0105240_11341367 3300009093 Bacteria 753
48 Ga0111539_10838935 3300009094 Bacteria 1069
49 Ga0105245_10003263 3300009098 Bacteria 14553
50 Ga0105245_10502967 3300009098 Bacteria 1228
51 Ga0105243_10350438 3300009148 Bacteria 1355
52 Ga0105248_10314227 3300009177 Bacteria 1764
53 Ga0105238_11078063 3300009551 Bacteria 826
54 Ga0105249_10026905 3300009553 Bacteria 5186
55 Ga0105249_10630603 3300009553 Bacteria 1128
56 Ga0105239_10115001 3300010375 Bacteria 2984
57 Ga0105239_11647642 3300010375 Bacteria 742
58 Ga0157369_10004822 3300013105 Bacteria 15838
59 Ga0157372_10219691 3300013307 Bacteria 2203
60 Ga0157380_11394268 3300014326 Bacteria 751
61 Ga0206354_10230575 3300020081 Bacteria 2909
62 Ga0206353_10584967 3300020082 Bacteria 9186
63 Ga0213876_10000617 3300021384 Bacteria 26182
64 Ga0207682_10000643 3300025893 Bacteria 16285
65 Ga0207705_10000002 3300025909 Bacteria 2046852
66 Ga0207662_10063299 3300025918 Bacteria 2224
67 Ga0207657_10003882 3300025919 Bacteria 15855
68 Ga0207657_10005419 3300025919 Bacteria 13331
69 Ga0207681_10019110 3300025923 Bacteria 4326
70 Ga0207681_10142860 3300025923 Bacteria 1785
71 Ga0207681_10998639 3300025923 Bacteria 702
72 Ga0207650_10274579 3300025925 Bacteria 1371
73 Ga0207659_10096979 3300025926 Bacteria 2214
74 Ga0207659_10101087 3300025926 Bacteria 2174
75 Ga0207644_10000478 3300025931 Bacteria 25815
76 Ga0207644_10489024 3300025931 Bacteria 1014
77 Ga0207644_10552219 3300025931 Bacteria 953
78 Ga0207690_10000051 3300025932 Bacteria 107367
79 Ga0207690_10002225 3300025932 Bacteria 11829
80 Ga0207690_10002726 3300025932 Bacteria 10666
81 Ga0207706_10179097 3300025933 Bacteria 1862
82 Ga0207706_10569518 3300025933 Bacteria 974
83 Ga0207670_10503319 3300025936 Bacteria 984
84 Ga0207661_10499861 3300025944 Bacteria 1111
85 Ga0207651_10555015 3300025960 Bacteria 999
86 Ga0207668_10000245 3300025972 Bacteria 36413
87 Ga0207640_10038082 3300025981 Bacteria 3032
88 Ga0207658_10000136 3300025986 Bacteria 77275
89 Ga0207677_10000013 3300026023 Bacteria 186519
90 Ga0207703_10001554 3300026035 Bacteria 20809
91 Ga0207639_10161779 3300026041 Bacteria 1887
92 Ga0207708_10304263 3300026075 Bacteria 1297
93 Ga0207641_10001236 3300026088 Bacteria 25571
94 Ga0207641_10027768 3300026088 Bacteria 4675
95 Ga0207641_10050944 3300026088 Bacteria 3505
96 Ga0207641_10055819 3300026088 Bacteria 3354
97 Ga0207676_10008821 3300026095 Bacteria 7178
98 Ga0207674_11010575 3300026116 Bacteria 801
99 Ga0268266_10000187 3300028379 Bacteria 110229
100 Ga0268265_10002072 3300028380 Bacteria 15654
101 Ga0268264_10000076 3300028381 Bacteria 255518
102 Ga0307408_100196644 3300031548 Bacteria 1629
103 Ga0307412_10321726 3300031911 Bacteria 1231
104 Ga0307412_10769298 3300031911 Bacteria 833
105 Ga0307409_101470707 3300031995 Bacteria 708
106 Ga0307416_100296569 3300032002 Bacteria 1604
107 Ga0307416_101284884 3300032002 Bacteria 838
108 Ga0307414_10000359 3300032004 Bacteria 25279
109 Ga0307414_10089339 3300032004 Bacteria 2283
110 Ga0307414_10522870 3300032004 Bacteria 1053
111 Ga0307411_10241262 3300032005 Bacteria 1415
112 Ga0436365_1161979 3300039437 Bacteria 35526
113 Ga0436363_0346119 3300039450 Bacteria 675
114 Ga0436363_1147236 3300039450 Bacteria 944
115 Ga0466973_0245500 3300044659 Bacteria 1267
116 Ga0451576_0019133 3300045051 Bacteria 7481
117 Ga0495638_0024927 3300046460 Bacteria 3893
118 Ga0495632_0155898 3300046519 Bacteria 1054
119 Ga0495642_0070658 3300046528 Bacteria 1460
120 Ga0495625_0011422 3300046660 Bacteria 7241
121 Ga0495625_0031825 3300046660 Bacteria 3919
122 Ga0495671_0086450 3300046692 Bacteria 1536
123 Ga0495649_0225700 3300046694 Bacteria 968
124 Ga0496106_0002295 3300048909 Bacteria 14266
125 Ga0496121_0320828 3300048924 Bacteria 1043
126 Ga0496122_0000176 3300048925 Bacteria 152190
127 Ga0496123_0000291 3300048926 Bacteria 97989
128 Ga0496126_0047121 3300048929 Bacteria 3947
129 Ga0501290_002270 3300049513 Bacteria 2496
130 Ga0501291_015134 3300049514 Bacteria 1163
131 Ga0501293_012232 3300049516 Bacteria 759
132 Ga0501034_0084941 3300049571 Bacteria 3167
133 Ga0501036_0224229 3300049572 Bacteria 1578
134 Ga0501043_0006996 3300049579 Bacteria 8986
135 Ga0501047_0002810 3300049581 Bacteria 16533
136 Ga0501069_0017248 3300049585 Bacteria 3884
137 Ga0501070_0040805 3300049586 Bacteria 3869
138 Ga0501071_0295223 3300049587 Bacteria 1228
139 Ga0501208_022412 3300049655 Bacteria 1047
140 Ga0501249_000061 3300049679 Bacteria 39083
141 Ga0501257_000511 3300049686 Bacteria 7705
142 Ga0501280_000539 3300049776 Bacteria 8895
143 Ga0501044_0119683 3300049823 Bacteria 2635
144 Ga0501044_0436982 3300049823 Bacteria 1217
145 Ga0501204_004094 3300049850 Bacteria 1559
146 nmdc:mga00v17_181394_c1 3300050491 Bacteria 989
147 nmdc:mga0k408_72315_c1 3300050493 Bacteria 2014
148 nmdc:mga07m45_568216_c1 3300050496 Bacteria 655
149 nmdc:mga0qj67_6949_c1 3300050509 Bacteria 8331
150 nmdc:mga08y16_671711_c1 3300050511 Bacteria 1038
151 nmdc:mga0n895_109310_c1 3300050512 Bacteria 2780
152 Ga0500643_000513 3300053087 Bacteria 27509
153 Ga0500643_022783 3300053087 Bacteria 2010
154 Ga0500644_0035624 3300053088 Bacteria 1614
155 Ga0500646_0016609 3300053090 Bacteria 1923
156 Ga0500650_0178269 3300053098 Bacteria 974
157 Ga0500556_0000144 3300053104 Bacteria 59354
158 Ga0500557_008807 3300053105 Bacteria 2438
159 Ga0500594_0003662 3300053118 Bacteria 3387
160 Ga0500608_017509 3300053122 Bacteria 3255
161 Ga0500642_0000001 3300053130 Bacteria 1468402
162 Ga0500559_0010290 3300053136 Bacteria 4021
163 Ga0500559_0023485 3300053136 Bacteria 2618
164 Ga0500568_0003109 3300053139 Bacteria 9463
165 Ga0500604_0000003 3300053151 Bacteria 148800
166 Ga0500616_0000087 3300053153 Bacteria 192225
167 Ga0500622_0203128 3300053156 Bacteria 900
168 Ga0500645_000780 3300053730 Bacteria 19276
169 2643731937 2643221541 Bacteria 5498788
170 2644036841 2643221605 Bacteria 4772303
171 2644041736 2643221606 Bacteria 5588032
172 2644394621 2643221671 Bacteria 5496681
173 Ga0070659_100004446
174 LJQas_1007027
175 JGI24739J22299_10074977
176 Ga0070658_10000033
177 Ga0070670_100017082
178 Ga0070670_100173139
179 Ga0070677_10000358
180 Ga0068868_100000001
181 Ga0070660_100001913
182 Ga0070660_100002218
183 Ga0070668_100000816
184 Ga0070669_100080611
185 Ga0070669_100154062
186 Ga0070675_100127905
187 Ga0070671_100000485
188 Ga0070671_100102714
189 Ga0070674_100194860
190 Ga0070673_100761468
191 Ga0070659_100000001
192 Ga0070659_100003367
193 Ga0070667_100000035
194 Ga0070662_100344325
195 Ga0070684_101051150
196 Ga0068853_100095802
197 Ga0068853_100120923
198 Ga0070672_100648727
199 Ga0070672_100819349
200 Ga0070686_100000387
201 Ga0070665_100000531
202 Ga0068854_100021862
203 Ga0068859_100111862
204 Ga0068864_100003840
205 Ga0068863_100007948
206 Ga0068863_100112864
207 Ga0068863_100223267
208 Ga0068863_100331828
209 Ga0068858_100001986
210 Ga0068860_100000106
211 Ga0068862_100001337
212 Ga0075364_10333766
213 Ga0075366_10067361
214 Ga0075430_100014947
215 Ga0075434_100058333
216 Ga0068865_101340536
217 Ga0097620_100111869
218 Ga0097620_100265366
219 Ga0105240_11341367
220 Ga0111539_10838935
221 Ga0105245_10003263
222 Ga0105245_10502967
223 Ga0105243_10350438
224 Ga0105248_10314227
225 Ga0105238_11078063
226 Ga0105249_10026905
227 Ga0105249_10630603
228 Ga0105239_10115001
229 Ga0105239_11647642
230 Ga0157369_10004822
231 Ga0157372_10219691
232 Ga0157380_11394268
233 Ga0206354_10230575
234 Ga0206353_10584967
235 Ga0213876_10000617
236 Ga0207682_10000643
237 Ga0207705_10000002
238 Ga0207662_10063299
239 Ga0207657_10003882
240 Ga0207657_10005419
241 Ga0207681_10019110
242 Ga0207681_10142860
243 Ga0207681_10998639
244 Ga0207650_10274579
245 Ga0207659_10096979
246 Ga0207659_10101087
247 Ga0207644_10000478
248 Ga0207644_10489024
249 Ga0207644_10552219
250 Ga0207690_10000051
251 Ga0207690_10002225
252 Ga0207690_10002726
253 Ga0207706_10179097
254 Ga0207706_10569518
255 Ga0207670_10503319
256 Ga0207661_10499861
257 Ga0207651_10555015
258 Ga0207668_10000245
259 Ga0207640_10038082
260 Ga0207658_10000136
261 Ga0207677_10000013
262 Ga0207703_10001554
263 Ga0207639_10161779
264 Ga0207708_10304263
265 Ga0207641_10001236
266 Ga0207641_10027768
267 Ga0207641_10050944
268 Ga0207641_10055819
269 Ga0207676_10008821
270 Ga0207674_11010575
271 Ga0268266_10000187
272 Ga0268265_10002072
273 Ga0268264_10000076
274 Ga0307408_100196644
275 Ga0307412_10321726
276 Ga0307412_10769298
277 Ga0307409_101470707
278 Ga0307416_100296569
279 Ga0307416_101284884
280 Ga0307414_10000359
281 Ga0307414_10089339
282 Ga0307414_10522870
283 Ga0307411_10241262
284 Ga0436365_1161979
285 Ga0436363_0346119
286 Ga0436363_1147236
287 Ga0466973_0245500
288 Ga0451576_0019133
289 Ga0495638_0024927
290 Ga0495632_0155898
291 Ga0495642_0070658
292 Ga0495625_0011422
293 Ga0495625_0031825
294 Ga0495671_0086450
295 Ga0495649_0225700
296 Ga0496106_0002295
297 Ga0496121_0320828
298 Ga0496122_0000176
299 Ga0496123_0000291
300 Ga0496126_0047121
301 Ga0501290_002270
302 Ga0501291_015134
303 Ga0501293_012232
304 Ga0501034_0084941
305 Ga0501036_0224229
306 Ga0501043_0006996
307 Ga0501047_0002810
308 Ga0501069_0017248
309 Ga0501070_0040805
310 Ga0501071_0295223
311 Ga0501208_022412
312 Ga0501249_000061
313 Ga0501257_000511
314 Ga0501280_000539
315 Ga0501044_0119683
316 Ga0501044_0436982
317 Ga0501204_004094
318 nmdc:mga00v17_181394_c1
319 nmdc:mga0k408_72315_c1
320 nmdc:mga07m45_568216_c1
321 nmdc:mga0qj67_6949_c1
322 nmdc:mga08y16_671711_c1
323 nmdc:mga0n895_109310_c1
324 Ga0500643_000513
325 Ga0500643_022783
326 Ga0500644_0035624
327 Ga0500646_0016609
328 Ga0500650_0178269
329 Ga0500556_0000144
330 Ga0500557_008807
331 Ga0500594_0003662
332 Ga0500608_017509
333 Ga0500642_0000001
334 Ga0500559_0010290
335 Ga0500559_0023485
336 Ga0500568_0003109
337 Ga0500604_0000003
338 Ga0500616_0000087
339 Ga0500622_0203128
340 Ga0500645_000780
341 2643731937
342 2644036841
343 2644041736
344 2644394621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

13

48

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.943 11 111
1fxj-assembly1.cif.gz_A crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase 0.9144 18 107
7d6c-assembly1.cif.gz_4 crystal structure of ccmm n-terminal domain in complex with ccmn 0.8889 13 114
3srt-assembly2.cif.gz_B the crystal structure of a maltose o-acetyltransferase from clostridium difficile 630 0.8276 14 117
7d6c-assembly1.cif.gz_4 crystal structure of ccmm n-terminal domain in complex with ccmn 0.8063 13 114
ID Description Score Start End Superfamily
af_F1QSV4_111_509_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9304 44 111 3.90.550.10
af_A0A1D6JL91_325_507_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9175 13 61 2.160.10.10
af_P9WN43_287_403_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8564 1 111 2.160.10.10
4isxA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8193 13 113 2.160.10.10
af_P09032_409_519_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.818 1 112 2.160.10.10
ID Description Score Start End GO Terms
AF-X1UHF3-F1-model_v4 Gamma carbonic anhydrase family protein 0.9959 4 112
AF-A0A2N6EUX9-F1-model_v4 Gamma carbonic anhydrase family protein 0.9956 4 70
AF-A0A660Z4J0-F1-model_v4 Gamma carbonic anhydrase family protein 0.9948 7 100
AF-A0A7V6DZV1-F1-model_v4 Gamma carbonic anhydrase family protein 0.9939 4 110
AF-A0A258WSN5-F1-model_v4 Gamma carbonic anhydrase family protein 0.9938 2 98

Map