F260581

General Info

Members Datasets Scaffolds Average Seq Length
172 147 157 268

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10035311|Ga0099794_100353113
Length 315
Sequence LSIGRHKPLAAILIQIAAVSDHEESASRVDIPITKEKSMSNSPSQGTALITGASTGIGAVYADRLAKRNYDLILVARNEARLKALGARLTRETGRSVTALPADLSDKSGLAKVEAILRDDQTIAMLVNNAGIGAVAPLLSADVEKMDDIIALNITALTHLAYAAAPAFVSRGAGTIINLASVVGISPETLNGVYGASKAYVLALSHSLQHELGAKGVRIQAVLPGATATEIWDKAGLPVKNLPASIVMSPEDMVDAALVGLDQGELVTIPSLHDADEWTRFEAARRALSKRFGNAAPAPRYRIGAPASADRAGRA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
7 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
10 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
11 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
12 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
13 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
14 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
56 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
86 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
87 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
102 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
147 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 1.74
Isolates 8.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.51
Nodule 1.74
Rhizoplane 2.91
Rhizosphere 63.95
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10027802 3300002067 Bacteria 1693
2 JGI25164J39214_1000068 3300002772 Bacteria 103192
3 JGI25151J46595_10000148 3300003187 Bacteria 92040
4 JGI25165J46597_1000086 3300003214 Bacteria 170731
5 rootL2_10040020 3300003322 Bacteria 4059
6 Ga0055526_1000032 3300003771 Bacteria 143118
7 Ga0055537_1000308 3300003773 Bacteria 33643
8 Ga0055524_1000054 3300003775 Bacteria 143118
9 Ga0055534_1000224 3300003784 Bacteria 41130
10 Ga0055528_1000021 3300003790 Bacteria 143118
11 Ga0055540_1000336 3300003792 Bacteria 40595
12 Ga0055531_10001233 3300003794 Bacteria 19460
13 Ga0065704_10088960 3300005289 Bacteria 2897
14 Ga0070663_100226867 3300005455 Bacteria 1469
15 Ga0070681_10466019 3300005458 Bacteria 1176
16 Ga0070698_100013857 3300005471 Bacteria 8525
17 Ga0070698_100046565 3300005471 Bacteria 4434
18 Ga0070698_100172190 3300005471 Bacteria 2105
19 Ga0070679_100027293 3300005530 Bacteria 5618
20 Ga0070697_100051578 3300005536 Bacteria 3342
21 Ga0070696_100045177 3300005546 Bacteria 3052
22 Ga0070693_100021066 3300005547 Bacteria 3449
23 Ga0070665_100098454 3300005548 Bacteria 2929
24 Ga0070665_100417701 3300005548 Bacteria 1350
25 Ga0068866_10299144 3300005718 Bacteria 1004
26 Ga0068858_100296192 3300005842 Bacteria 1543
27 Ga0068860_100073338 3300005843 Bacteria 3254
28 Ga0081539_10001960 3300005985 Bacteria 31362
29 Ga0081539_10015304 3300005985 Bacteria 5585
30 Ga0070716_100051387 3300006173 Unclassified 2343
31 Ga0075433_10135443 3300006852 Bacteria 2189
32 Ga0075433_10217838 3300006852 Bacteria 1696
33 Ga0075435_100196997 3300007076 Bacteria 1706
34 Ga0075435_100285994 3300007076 Bacteria 1408
35 Ga0099794_10020439 3300007265 Bacteria 2997
36 Ga0099794_10035311 3300007265 Bacteria 2359
37 Ga0105240_10010061 3300009093 Bacteria 13317
38 Ga0105245_10319156 3300009098 Bacteria 1530
39 Ga0114129_10009768 3300009147 Bacteria 13682
40 Ga0114129_10066617 3300009147 Bacteria 5023
41 Ga0105241_10285597 3300009174 Bacteria 1411
42 Ga0105248_10034489 3300009177 Bacteria 5659
43 Ga0105238_10030499 3300009551 Bacteria 5489
44 Ga0105239_10024425 3300010375 Bacteria 6660
45 Ga0105239_10052879 3300010375 Bacteria 4454
46 Ga0105239_10127701 3300010375 Bacteria 2827
47 Ga0105246_10069118 3300011119 Bacteria 2479
48 Ga0157378_10001842 3300013297 Bacteria 19034
49 Ga0157378_10510078 3300013297 Bacteria 1203
50 Ga0163162_10013551 3300013306 Bacteria 7962
51 Ga0163162_10032668 3300013306 Bacteria 5170
52 Ga0163163_10278308 3300014325 Bacteria 1725
53 Ga0183360_10001 3300015689 Bacteria 3943671
54 Ga0209760_100019 3300025207 Bacteria 170806
55 Ga0207427_100011 3300025231 Bacteria 640076
56 Ga0209437_100044 3300025233 Bacteria 430619
57 Ga0209233_1000057 3300025261 Bacteria 430619
58 Ga0209565_1000001 3300025263 Bacteria 2950419
59 Ga0209565_1004007 3300025263 Bacteria 4595
60 Ga0209673_1000001 3300025273 Bacteria 3176258
61 Ga0209675_1000001 3300025291 Bacteria 2950293
62 Ga0209676_1000799 3300025292 Bacteria 41601
63 Ga0209676_1029196 3300025292 Bacteria 1707
64 Ga0209025_1000005 3300025294 Bacteria 1272149
65 Ga0209564_1000001 3300025295 Bacteria 3176258
66 Ga0209758_1016229 3300025297 Bacteria 3796
67 Ga0209758_1024235 3300025297 Bacteria 2710
68 Ga0209758_1064872 3300025297 Bacteria 1181
69 Ga0209050_1002053 3300025298 Bacteria 18548
70 Ga0209050_1002487 3300025298 Bacteria 15596
71 Ga0209256_1000002 3300025299 Bacteria 1906740
72 Ga0209051_1000626 3300025303 Bacteria 40647
73 Ga0209257_1000903 3300025304 Bacteria 41596
74 Ga0209257_1007965 3300025304 Bacteria 6201
75 Ga0207642_10239433 3300025899 Bacteria 1024
76 Ga0207685_10036599 3300025905 Bacteria 1801
77 Ga0207684_10001545 3300025910 Bacteria 24619
78 Ga0207684_10003042 3300025910 Bacteria 16621
79 Ga0207707_10375513 3300025912 Bacteria 1223
80 Ga0207671_10042596 3300025914 Bacteria 3360
81 Ga0207693_10136011 3300025915 Unclassified 1932
82 Ga0207663_10175964 3300025916 Bacteria 1524
83 Ga0207652_10002703 3300025921 Bacteria 14885
84 Ga0207646_10014101 3300025922 Bacteria 7600
85 Ga0207646_10095703 3300025922 Bacteria 2660
86 Ga0207694_10272151 3300025924 Bacteria 1389
87 Ga0207665_10115560 3300025939 Unclassified 1890
88 Ga0207665_10158058 3300025939 Unclassified 1628
89 Ga0207711_10186648 3300025941 Bacteria 1888
90 Ga0209371_1012772 3300027312 Bacteria 2406
91 Ga0209371_1020099 3300027312 Bacteria 1651
92 Ga0209588_1007161 3300027671 Bacteria 3271
93 Ga0209588_1041847 3300027671 Bacteria 1479
94 Ga0265354_1000564 3300028016 Bacteria 6346
95 Ga0265356_1009702 3300028017 Unclassified 1082
96 Ga0265355_1000063 3300028036 Unclassified 3625
97 Ga0268266_10123969 3300028379 Bacteria 2303
98 Ga0268264_10191317 3300028381 Bacteria 1865
99 Ga0268256_1013969 3300030500 Bacteria 2406
100 Ga0268256_1022510 3300030500 Bacteria 1651
101 Ga0265770_1001012 3300030878 Bacteria 3891
102 Ga0265765_1009949 3300030879 Bacteria 1054
103 Ga0265760_10002417 3300031090 Bacteria 5454
104 Ga0307516_10178318 3300031730 Bacteria 1860
105 Ga0395901_0383273 3300038443 Bacteria 1447
106 Ga0436361_0726920 3300039447 Bacteria 29762
107 Ga0439438_010398 3300041405 Bacteria 2943
108 Ga0439447_011020 3300041407 Bacteria 2658
109 Ga0439466_0000514 3300041411 Bacteria 14609
110 Ga0439432_042675 3300042006 Bacteria 1433
111 Ga0439452_047938 3300042010 Bacteria 986
112 Ga0439456_031560 3300042013 Bacteria 1135
113 Ga0439434_0000441 3300042435 Bacteria 11875
114 Ga0451577_0096388 3300042876 Bacteria 2641
115 Ga0439440_0000389 3300042993 Bacteria 7365
116 Ga0466969_0002273 3300044656 Bacteria 10263
117 Ga0466980_0237463 3300044668 Bacteria 1141
118 Ga0466966_0012126 3300044684 Bacteria 5709
119 Ga0466961_0003191 3300044693 Bacteria 10206
120 Ga0453684_0125566 3300044712 Bacteria 3089
121 Ga0466960_0200842 3300044901 Bacteria 1089
122 Ga0466959_0007176 3300045049 Bacteria 7800
123 Ga0451576_0248741 3300045051 Bacteria 1858
124 Ga0495653_0037952 3300046463 Bacteria 3782
125 Ga0495580_0062557 3300046472 Bacteria 2611
126 Ga0495639_0046109 3300046475 Bacteria 1973
127 Ga0495606_0015242 3300046507 Bacteria 5935
128 Ga0495586_0154086 3300046535 Bacteria 1294
129 Ga0495587_0000089 3300046536 Bacteria 70764
130 Ga0495667_0251867 3300046559 Bacteria 1124
131 Ga0495668_0000026 3300046616 Bacteria 297287
132 Ga0495635_0063399 3300046663 Bacteria 2538
133 Ga0495646_0001803 3300046680 Bacteria 12852
134 Ga0495649_0014188 3300046694 Bacteria 4576
135 Ga0495684_0199169 3300047471 Bacteria 1477
136 Ga0495686_0022298 3300047472 Bacteria 4191
137 Ga0495593_0064646 3300047673 Bacteria 1909
138 Ga0496100_0104081 3300048903 Bacteria 1961
139 Ga0496102_0000038 3300048905 Bacteria 198844
140 Ga0496102_0086082 3300048905 Bacteria 2902
141 Ga0496106_0021098 3300048909 Bacteria 4836
142 Ga0496115_0125264 3300048918 Bacteria 2116
143 Ga0496121_0007358 3300048924 Bacteria 13309
144 Ga0496122_0032445 3300048925 Bacteria 4318
145 Ga0496123_0011459 3300048926 Bacteria 7680
146 Ga0496126_0341848 3300048929 Bacteria 1226
147 Ga0501080_0034764 3300049742 Bacteria 4706
148 nmdc:mga05p37_42340_c1 3300050507 Bacteria 5595
149 nmdc:mga0rr50_497762_c1 3300050513 Bacteria 1036
150 nmdc:mga0a205_290621_c1 3300050515 Bacteria 1509
151 nmdc:mga0sz30_180336_c1 3300050516 Bacteria 937
152 Ga0495601_0086717 3300053077 Bacteria 2012
153 Ga0500578_0043381 3300053086 Bacteria 2887
154 Ga0500651_0095246 3300053093 Bacteria 1830
155 Ga0500641_0026884 3300053096 Bacteria 2237
156 Ga0500577_0024944 3300053142 Bacteria 2017
157 Ga0500588_0003264 3300053146 Bacteria 3403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_180336_c1 nmdc:mga0sz30_180336_c1_240_905 221
2 3300046680 Ga0495646_0001803 Ga0495646_0001803_5853_6686 225
3 3300046507 Ga0495606_0015242 Ga0495606_0015242_983_1792 251
4 3300047472 Ga0495686_0022298 Ga0495686_0022298_1305_2117 254
5 iso_pu_bacteria 2941489479 2941490507 255
6 3300042993 Ga0439440_0000389 Ga0439440_0000389_614_1393 257
7 iso_pu_bacteria 2523231067 2523469694 257
8 iso_pu_bacteria 2501025501 2501072399 258
9 iso_pu_bacteria 2501025504 2501412409 258
10 iso_pu_bacteria 2510917014 2511101454 258
11 iso_pu_bacteria 2510917015 2511107943 258
12 iso_pu_bacteria 2511231007 2511270471 258
13 iso_pu_bacteria 2515154123 2515689601 258
14 iso_pu_bacteria 2821123053 2821130053 258
15 iso_pu_bacteria 2883087390 2883090354 258
16 iso_pu_bacteria 2919100787 2919108118 258
17 iso_pu_bacteria 8024479707 8024482399 258
18 3300038443 Ga0395901_0383273 Ga0395901_0383273_379_1158 259
19 3300048924 Ga0496121_0007358 Ga0496121_0007358_1126_1905 259
20 iso_pu_bacteria 2643221593 2643976677 259
21 3300049742 Ga0501080_0034764 Ga0501080_0034764_1460_2293 260
22 3300005547 Ga0070693_100021066 Ga0070693_1000210662 261
23 3300005548 Ga0070665_100098454 Ga0070665_1000984541 261
24 3300028379 Ga0268266_10123969 Ga0268266_101239691 261
25 3300046694 Ga0495649_0014188 Ga0495649_0014188_2363_3154 261
26 3300002772 JGI25164J39214_1000068 JGI25164J39214_100006845 262
27 3300003214 JGI25165J46597_1000086 JGI25165J46597_1000086111 262
28 3300003322 rootL2_10040020 rootL2_100400203 262
29 3300003794 Ga0055531_10001233 Ga0055531_100012339 262
30 3300005289 Ga0065704_10088960 Ga0065704_100889603 262
31 3300005458 Ga0070681_10466019 Ga0070681_104660191 262
32 3300005530 Ga0070679_100027293 Ga0070679_1000272934 262
33 3300005985 Ga0081539_10015304 Ga0081539_100153045 262
34 3300009093 Ga0105240_10010061 Ga0105240_1001006110 262
35 3300010375 Ga0105239_10127701 Ga0105239_101277012 262
36 3300014325 Ga0163163_10278308 Ga0163163_102783082 262
37 3300025207 Ga0209760_100019 Ga0209760_10001958 262
38 3300025231 Ga0207427_100011 Ga0207427_10001158 262
39 3300025233 Ga0209437_100044 Ga0209437_10004458 262
40 3300025261 Ga0209233_1000057 Ga0209233_100005758 262
41 3300025263 Ga0209565_1004007 Ga0209565_10040074 262
42 3300025292 Ga0209676_1000799 Ga0209676_100079934 262
43 3300025297 Ga0209758_1024235 Ga0209758_10242352 262
44 3300025298 Ga0209050_1002053 Ga0209050_100205314 262
45 3300025298 Ga0209050_1002487 Ga0209050_10024873 262
46 3300025303 Ga0209051_1000626 Ga0209051_100062625 262
47 3300025304 Ga0209257_1000903 Ga0209257_100090334 262
48 3300025912 Ga0207707_10375513 Ga0207707_103755132 262
49 3300025921 Ga0207652_10002703 Ga0207652_1000270314 262
50 3300025924 Ga0207694_10272151 Ga0207694_102721512 262
51 3300039447 Ga0436361_0726920 Ga0436361_0726920_7511_8308 262
52 3300041405 Ga0439438_010398 Ga0439438_010398_1021_1809 262
53 3300041407 Ga0439447_011020 Ga0439447_011020_1722_2510 262
54 3300041411 Ga0439466_0000514 Ga0439466_0000514_7306_8094 262
55 3300042006 Ga0439432_042675 Ga0439432_042675_403_1191 262
56 3300042010 Ga0439452_047938 Ga0439452_047938_70_858 262
57 3300042013 Ga0439456_031560 Ga0439456_031560_71_859 262
58 3300042435 Ga0439434_0000441 Ga0439434_0000441_688_1476 262
59 3300044656 Ga0466969_0002273 Ga0466969_0002273_6072_6860 262
60 3300044668 Ga0466980_0237463 Ga0466980_0237463_193_981 262
61 3300044684 Ga0466966_0012126 Ga0466966_0012126_738_1526 262
62 3300044693 Ga0466961_0003191 Ga0466961_0003191_2341_3129 262
63 3300044901 Ga0466960_0200842 Ga0466960_0200842_106_894 262
64 3300045049 Ga0466959_0007176 Ga0466959_0007176_1069_1857 262
65 3300046463 Ga0495653_0037952 Ga0495653_0037952_1468_2256 262
66 3300046536 Ga0495587_0000089 Ga0495587_0000089_66944_67732 262
67 3300047673 Ga0495593_0064646 Ga0495593_0064646_23_811 262
68 3300048905 Ga0496102_0000038 Ga0496102_0000038_75288_76076 262
69 3300053096 Ga0500641_0026884 Ga0500641_0026884_317_1105 262
70 3300053142 Ga0500577_0024944 Ga0500577_0024944_1155_1952 262
71 3300053146 Ga0500588_0003264 Ga0500588_0003264_2171_2959 262
72 3300003187 JGI25151J46595_10000148 JGI25151J46595_1000014836 263
73 3300003792 Ga0055540_1000336 Ga0055540_100033624 263
74 3300005548 Ga0070665_100417701 Ga0070665_1004177011 263
75 3300025292 Ga0209676_1029196 Ga0209676_10291961 263
76 3300025294 Ga0209025_1000005 Ga0209025_1000005616 263
77 3300025297 Ga0209758_1016229 Ga0209758_10162292 263
78 3300025304 Ga0209257_1007965 Ga0209257_10079654 263
79 iso_pu_bacteria 2791355010 2792313865 263
80 3300005455 Ga0070663_100226867 Ga0070663_1002268671 264
81 3300009098 Ga0105245_10319156 Ga0105245_103191563 264
82 3300009174 Ga0105241_10285597 Ga0105241_102855972 264
83 3300011119 Ga0105246_10069118 Ga0105246_100691183 264
84 3300013297 Ga0157378_10510078 Ga0157378_105100781 264
85 3300025297 Ga0209758_1064872 Ga0209758_10648721 264
86 3300005471 Ga0070698_100046565 Ga0070698_1000465656 265
87 3300005471 Ga0070698_100172190 Ga0070698_1001721902 265
88 3300005536 Ga0070697_100051578 Ga0070697_1000515782 265
89 3300005546 Ga0070696_100045177 Ga0070696_1000451771 265
90 3300005718 Ga0068866_10299144 Ga0068866_102991442 265
91 3300005842 Ga0068858_100296192 Ga0068858_1002961922 265
92 3300005843 Ga0068860_100073338 Ga0068860_1000733385 265
93 3300006173 Ga0070716_100051387 Ga0070716_1000513872 265
94 3300006852 Ga0075433_10135443 Ga0075433_101354432 265
95 3300006852 Ga0075433_10217838 Ga0075433_102178382 265
96 3300007076 Ga0075435_100196997 Ga0075435_1001969972 265
97 3300007265 Ga0099794_10020439 Ga0099794_100204393 265
98 3300009147 Ga0114129_10009768 Ga0114129_1000976814 265
99 3300009147 Ga0114129_10066617 Ga0114129_100666172 265
100 3300009177 Ga0105248_10034489 Ga0105248_100344893 265
101 3300010375 Ga0105239_10052879 Ga0105239_100528793 265
102 3300013297 Ga0157378_10001842 Ga0157378_1000184217 265
103 3300013306 Ga0163162_10013551 Ga0163162_100135513 265
104 3300025899 Ga0207642_10239433 Ga0207642_102394331 265
105 3300025905 Ga0207685_10036599 Ga0207685_100365992 265
106 3300025910 Ga0207684_10001545 Ga0207684_100015459 265
107 3300025910 Ga0207684_10003042 Ga0207684_100030428 265
108 3300025914 Ga0207671_10042596 Ga0207671_100425962 265
109 3300025915 Ga0207693_10136011 Ga0207693_101360112 265
110 3300025916 Ga0207663_10175964 Ga0207663_101759641 265
111 3300025922 Ga0207646_10014101 Ga0207646_100141013 265
112 3300025922 Ga0207646_10095703 Ga0207646_100957032 265
113 3300025939 Ga0207665_10115560 Ga0207665_101155602 265
114 3300025939 Ga0207665_10158058 Ga0207665_101580582 265
115 3300025941 Ga0207711_10186648 Ga0207711_101866482 265
116 3300027671 Ga0209588_1007161 Ga0209588_10071614 265
117 3300027671 Ga0209588_1041847 Ga0209588_10418472 265
118 3300028016 Ga0265354_1000564 Ga0265354_10005643 265
119 3300028017 Ga0265356_1009702 Ga0265356_10097022 265
120 3300028036 Ga0265355_1000063 Ga0265355_10000633 265
121 3300028381 Ga0268264_10191317 Ga0268264_101913172 265
122 3300030878 Ga0265770_1001012 Ga0265770_10010124 265
123 3300030879 Ga0265765_1009949 Ga0265765_10099492 265
124 3300031090 Ga0265760_10002417 Ga0265760_100024175 265
125 3300031730 Ga0307516_10178318 Ga0307516_101783182 265
126 3300042876 Ga0451577_0096388 Ga0451577_0096388_973_1800 265
127 3300044712 Ga0453684_0125566 Ga0453684_0125566_1371_2198 265
128 3300045051 Ga0451576_0248741 Ga0451576_0248741_994_1821 265
129 3300046472 Ga0495580_0062557 Ga0495580_0062557_937_1743 265
130 3300046475 Ga0495639_0046109 Ga0495639_0046109_361_1167 265
131 3300046535 Ga0495586_0154086 Ga0495586_0154086_115_921 265
132 3300046559 Ga0495667_0251867 Ga0495667_0251867_167_973 265
133 3300046663 Ga0495635_0063399 Ga0495635_0063399_601_1407 265
134 3300047471 Ga0495684_0199169 Ga0495684_0199169_613_1419 265
135 3300048903 Ga0496100_0104081 Ga0496100_0104081_1053_1868 265
136 3300048905 Ga0496102_0086082 Ga0496102_0086082_1532_2347 265
137 3300048909 Ga0496106_0021098 Ga0496106_0021098_2665_3480 265
138 3300048918 Ga0496115_0125264 Ga0496115_0125264_1072_1887 265
139 3300048929 Ga0496126_0341848 Ga0496126_0341848_243_1055 265
140 3300050507 nmdc:mga05p37_42340_c1 nmdc:mga05p37_42340_c1_3607_4416 265
141 3300050515 nmdc:mga0a205_290621_c1 nmdc:mga0a205_290621_c1_272_1081 265
142 3300053077 Ga0495601_0086717 Ga0495601_0086717_1131_1937 265
143 3300053086 Ga0500578_0043381 Ga0500578_0043381_509_1312 267
144 3300053093 Ga0500651_0095246 Ga0500651_0095246_704_1507 267
145 3300046616 Ga0495668_0000026 Ga0495668_0000026_217922_218734 268
146 3300005985 Ga0081539_10001960 Ga0081539_1000196020 269
147 3300007076 Ga0075435_100285994 Ga0075435_1002859942 269
148 3300050513 nmdc:mga0rr50_497762_c1 nmdc:mga0rr50_497762_c1_162_989 269
149 3300005471 Ga0070698_100013857 Ga0070698_1000138572 270
150 3300007265 Ga0099794_10035311 Ga0099794_100353113 270
151 3300009551 Ga0105238_10030499 Ga0105238_100304992 270
152 3300010375 Ga0105239_10024425 Ga0105239_100244253 270
153 3300013306 Ga0163162_10032668 Ga0163162_100326682 270
154 3300003771 Ga0055526_1000032 Ga0055526_100003224 271
155 3300003773 Ga0055537_1000308 Ga0055537_10003089 271
156 3300003775 Ga0055524_1000054 Ga0055524_100005424 271
157 3300003784 Ga0055534_1000224 Ga0055534_100022414 271
158 3300003790 Ga0055528_1000021 Ga0055528_100002192 271
159 3300015689 Ga0183360_10001 Ga0183360_100011667 271
160 3300025263 Ga0209565_1000001 Ga0209565_10000012144 271
161 3300025273 Ga0209673_1000001 Ga0209673_10000012144 271
162 3300025291 Ga0209675_1000001 Ga0209675_1000001388 271
163 3300025295 Ga0209564_1000001 Ga0209564_1000001550 271
164 3300025299 Ga0209256_1000002 Ga0209256_10000021002 271
165 iso_pu_bacteria 2919527303 2919533607 271
166 3300027312 Ga0209371_1012772 Ga0209371_10127722 274
167 3300027312 Ga0209371_1020099 Ga0209371_10200992 274
168 3300030500 Ga0268256_1013969 Ga0268256_10139692 274
169 3300030500 Ga0268256_1022510 Ga0268256_10225102 274
170 3300002067 JGI24735J21928_10027802 JGI24735J21928_100278022 275
171 3300048925 Ga0496122_0032445 Ga0496122_0032445_2075_2914 275
172 3300048926 Ga0496123_0011459 Ga0496123_0011459_5119_5958 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

238

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

259

0.92

PF08659

KR

KR domain

46

223

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

48

223

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9908 16 272
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9901 17 271
6zdz-assembly1.cif.gz_B tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9871 17 271
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.987 16 272
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9862 17 271
ID Description Score Start End Superfamily
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9912 16 272 3.40.50.720
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9873 16 272 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 18 68 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 15 242 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 102 201 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M5AM34-F1-model_v4 deleted 1 15 103
AF-A0A7Z2XDU6-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9868 15 271 GO:0016491
AF-A0A3M5AM34-F1-model_v4 deleted 0.9781 15 103
AF-A0A3R8NDT4-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9719 12 275 GO:0016491
AF-A0A3M5ZT92-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family 0.9701 4 275 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.89 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map