F261122

General Info

Members Datasets Scaffolds Average Seq Length
172 154 344 113

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_244224|Ga0400483_244224_3114_3455
Length 104
Sequence MAKYTSETLDLVFAALSDGTRRPACVSDLARPFDMALPSFLKHLDKLERAQLVTTTKRGRVRWVTLETDRLADAEAWIERYKSSWTRRLDKLAHLAETLERTSS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
136 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
137 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
138 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
139 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
140 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
141 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
142 2643221557 Ensifer sp. Root558 Isolate Unclassified
143 2643221607 Rhizobium sp. Root73 Isolate Unclassified
144 2643221610 Ensifer sp. Root74 Isolate Unclassified
145 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
146 2643221668 Ensifer sp. Root423 Isolate Unclassified
147 2643221675 Ensifer sp. Root1298 Isolate Unclassified
148 2643221680 Ensifer sp. Root1312 Isolate Unclassified
149 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
150 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
151 2643221726 Ensifer sp. Root954 Isolate Unclassified
152 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
153 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
154 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 0
Isolates 10.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.07
Nodule 0
Rhizoplane 3.49
Rhizosphere 56.4
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_244224 3300039062 Bacteria 7473
2 JGI24740J21852_10087298 3300001979 Bacteria 809
3 JGI25159J45721_1000023 3300002987 Bacteria 116643
4 JGI25151J46595_10005675 3300003187 Bacteria 6415
5 JGI25160J50197_1000061 3300003354 Bacteria 116643
6 JGI25161J50226_1002657 3300003374 Bacteria 4471
7 Ga0055526_1001848 3300003771 Bacteria 14656
8 Ga0055524_1003584 3300003775 Bacteria 7487
9 Ga0055536_1002594 3300003781 Bacteria 10067
10 Ga0055530_10014794 3300003791 Bacteria 2578
11 Ga0055540_1037751 3300003792 Bacteria 1063
12 Ga0055531_10011199 3300003794 Bacteria 4358
13 Ga0055543_1000247 3300004625 Bacteria 41352
14 Ga0065165_1000047 3300005262 Bacteria 197811
15 Ga0065714_10287357 3300005288 Bacteria 713
16 Ga0065712_10112959 3300005290 Bacteria 1791
17 Ga0065715_10179766 3300005293 Bacteria 1485
18 Ga0070690_100458601 3300005330 Bacteria 946
19 Ga0070692_10529927 3300005345 Bacteria 768
20 Ga0070668_100287508 3300005347 Bacteria 1375
21 Ga0070675_101487298 3300005354 Bacteria 625
22 Ga0070671_100597630 3300005355 Bacteria 953
23 Ga0070673_100742597 3300005364 Bacteria 903
24 Ga0070667_100702255 3300005367 Bacteria 936
25 Ga0070711_100041471 3300005439 Bacteria 3108
26 Ga0070707_100090842 3300005468 Bacteria 2956
27 Ga0070679_101250062 3300005530 Bacteria 688
28 Ga0070679_101301864 3300005530 Bacteria 672
29 Ga0070684_100585333 3300005535 Bacteria 1037
30 Ga0070665_100244083 3300005548 Bacteria 1796
31 Ga0070704_101171087 3300005549 Bacteria 700
32 Ga0068855_100008020 3300005563 Bacteria 12754
33 Ga0068856_100033148 3300005614 Bacteria 5058
34 Ga0068852_100605627 3300005616 Bacteria 1100
35 Ga0068851_10434250 3300005834 Bacteria 778
36 Ga0068863_100756160 3300005841 Bacteria 968
37 Ga0068858_100645842 3300005842 Bacteria 1028
38 Ga0068858_101181825 3300005842 Bacteria 752
39 Ga0075365_10059608 3300006038 Bacteria 2545
40 Ga0075364_10389570 3300006051 Unclassified 951
41 Ga0075364_10473801 3300006051 Bacteria 856
42 Ga0070715_10096562 3300006163 Bacteria 1370
43 Ga0070712_100495350 3300006175 Bacteria 1023
44 Ga0075362_10266822 3300006177 Bacteria 844
45 Ga0068871_101362289 3300006358 Bacteria 668
46 Ga0068865_101608054 3300006881 Bacteria 584
47 Ga0099794_10066295 3300007265 Bacteria 1762
48 Ga0105240_10017650 3300009093 Bacteria 9609
49 Ga0111539_10000100 3300009094 Bacteria 91427
50 Ga0105241_10713444 3300009174 Unclassified 916
51 Ga0105238_12538271 3300009551 Unclassified 548
52 Ga0105238_12632567 3300009551 Bacteria 539
53 Ga0105239_10050707 3300010375 Bacteria 4551
54 Ga0157369_10363261 3300013105 Bacteria 1503
55 Ga0171463_1001 3300013249 Bacteria 1406070
56 Ga0163162_12088540 3300013306 Bacteria 650
57 Ga0183365_10498 3300015684 Bacteria 1290
58 Ga0183363_1069 3300015690 Bacteria 30410
59 Ga0209436_105616 3300025208 Bacteria 2853
60 Ga0209565_1053947 3300025263 Bacteria 713
61 Ga0209673_1035726 3300025273 Bacteria 1484
62 Ga0209130_1000005 3300025284 Bacteria 599620
63 Ga0209676_1001886 3300025292 Bacteria 17112
64 Ga0209025_1001809 3300025294 Bacteria 25289
65 Ga0209025_1037413 3300025294 Bacteria 2153
66 Ga0209025_1110776 3300025294 Bacteria 844
67 Ga0209564_1000113 3300025295 Bacteria 211564
68 Ga0209050_1001845 3300025298 Bacteria 20536
69 Ga0209256_1000779 3300025299 Bacteria 41192
70 Ga0209256_1006466 3300025299 Bacteria 6182
71 Ga0207426_1000015 3300025302 Bacteria 599316
72 Ga0209051_1061763 3300025303 Bacteria 1175
73 Ga0209257_1005154 3300025304 Bacteria 9430
74 Ga0207656_10333010 3300025321 Bacteria 756
75 Ga0207705_11348237 3300025909 Bacteria 544
76 Ga0207693_10273593 3300025915 Bacteria 1323
77 Ga0207663_10085242 3300025916 Bacteria 2080
78 Ga0207660_10985302 3300025917 Bacteria 688
79 Ga0207657_10971989 3300025919 Bacteria 652
80 Ga0207652_10093648 3300025921 Bacteria 2644
81 Ga0207646_10085747 3300025922 Bacteria 2817
82 Ga0207659_11618049 3300025926 Bacteria 553
83 Ga0207664_10416155 3300025929 Bacteria 1197
84 Ga0207689_11316381 3300025942 Bacteria 607
85 Ga0207667_10000429 3300025949 Bacteria 56506
86 Ga0207658_11652487 3300025986 Bacteria 585
87 Ga0207702_10028529 3300026078 Bacteria 4640
88 Ga0207698_10890571 3300026142 Bacteria 897
89 Ga0207698_12318280 3300026142 Bacteria 549
90 Ga0209588_1118490 3300027671 Bacteria 848
91 Ga0207428_10003169 3300027907 Bacteria 16100
92 Ga0268266_10470286 3300028379 Bacteria 1197
93 Ga0268264_11103383 3300028381 Bacteria 802
94 Ga0265338_10076759 3300028800 Bacteria 2828
95 Ga0307513_10850774 3300031456 Bacteria 619
96 Ga0307408_100076074 3300031548 Bacteria 2496
97 Ga0307408_100143963 3300031548 Bacteria 1874
98 Ga0307410_10233474 3300031852 Bacteria 1421
99 Ga0307406_11005471 3300031901 Bacteria 716
100 Ga0307409_100354691 3300031995 Bacteria 1385
101 Ga0307409_101058188 3300031995 Bacteria 831
102 Ga0307416_102174857 3300032002 Bacteria 656
103 Ga0373931_0740610 3300035691 Bacteria 652
104 Ga0439439_0021052 3300041406 Bacteria 1623
105 Ga0439447_102121 3300041407 Bacteria 658
106 Ga0439466_0151548 3300041411 Bacteria 710
107 Ga0451793_0276976 3300041452 Bacteria 904
108 Ga0451807_2032592 3300041486 Bacteria 730
109 Ga0439433_0161108 3300041999 Bacteria 581
110 Ga0439452_071001 3300042010 Bacteria 767
111 Ga0450918_005656 3300042531 Bacteria 2242
112 Ga0495638_0000273 3300046460 Bacteria 69837
113 Ga0495638_0158318 3300046460 Bacteria 1308
114 Ga0495633_0096923 3300046558 Bacteria 1370
115 Ga0495625_0000451 3300046660 Bacteria 61644
116 Ga0495588_0047730 3300046674 Bacteria 2199
117 Ga0495670_0015906 3300046691 Bacteria 3697
118 Ga0495581_0065957 3300047315 Bacteria 2093
119 Ga0495686_0044732 3300047472 Bacteria 2802
120 Ga0495686_0584985 3300047472 Bacteria 579
121 Ga0496109_1233670 3300048912 Bacteria 684
122 Ga0496111_0192850 3300048914 Bacteria 1514
123 Ga0496112_0218891 3300048915 Bacteria 1860
124 Ga0496117_0066879 3300048920 Bacteria 2435
125 Ga0496118_0170125 3300048921 Bacteria 1333
126 Ga0496122_0027777 3300048925 Bacteria 4826
127 Ga0496124_0972935 3300048927 Bacteria 508
128 Ga0501033_0060612 3300049570 Bacteria 2791
129 Ga0501034_0089370 3300049571 Bacteria 3078
130 Ga0501034_0791961 3300049571 Bacteria 841
131 Ga0501047_1326998 3300049581 Bacteria 534
132 Ga0501076_1217127 3300049592 Bacteria 620
133 Ga0501080_0494930 3300049742 Bacteria 1093
134 nmdc:mga03683_253506_c1 3300050489 Bacteria 818
135 nmdc:mga03683_656122_c1 3300050489 Bacteria 517
136 nmdc:mga00v17_380622_c1 3300050491 Unclassified 917
137 nmdc:mga00v17_466802_c1 3300050491 Bacteria 819
138 nmdc:mga0yw44_207203_c1 3300050492 Bacteria 1296
139 nmdc:mga0yw44_48592_c1 3300050492 Unclassified 2558
140 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
141 nmdc:mga0a205_672481_c1 3300050515 Bacteria 886
142 Ga0500644_0237490 3300053088 Bacteria 765
143 Ga0500654_129194 3300053099 Bacteria 963
144 Ga0500562_026780 3300053108 Bacteria 1512
145 Ga0500572_000358 3300053111 Bacteria 16238
146 Ga0500658_0006543 3300053134 Bacteria 4320
147 Ga0500568_0000474 3300053139 Bacteria 29720
148 Ga0500588_0000024 3300053146 Bacteria 36113
149 Ga0500604_0032128 3300053151 Bacteria 1545
150 Ga0500616_0012360 3300053153 Bacteria 5000
151 Ga0500616_0013392 3300053153 Bacteria 4763
152 Ga0500616_0228870 3300053153 Bacteria 806
153 Ga0500634_0000031 3300053161 Bacteria 75547
154 Ga0500609_042598 3300053731 Bacteria 628
155 2585165241 2582581283 Bacteria 6030556
156 2585266542 2582581306 Bacteria 6450535
157 2585387558 2582581865 Bacteria 6644329
158 2585394164 2582581866 Bacteria 6859583
159 2600195230 2599185352 Bacteria 7228948
160 2643805738 2643221557 Bacteria 7184309
161 2644046904 2643221607 Bacteria 6314006
162 2644065913 2643221610 Bacteria 7480339
163 2644203657 2643221636 Bacteria 6583769
164 2644380218 2643221668 Bacteria 7306521
165 2644417244 2643221675 Bacteria 7473456
166 2644450640 2643221680 Bacteria 7473610
167 2644479693 2643221686 Bacteria 6310811
168 2644497232 2643221689 Bacteria 6042950
169 2644692935 2643221726 Bacteria 7455827
170 2920822786 2920822456 Bacteria 6897201
171 2941504071 2941499720 Bacteria 7599444
172 8054003403 8054002106 Bacteria 7987183
173 Ga0400483_244224
174 JGI24740J21852_10087298
175 JGI25159J45721_1000023
176 JGI25151J46595_10005675
177 JGI25160J50197_1000061
178 JGI25161J50226_1002657
179 Ga0055526_1001848
180 Ga0055524_1003584
181 Ga0055536_1002594
182 Ga0055530_10014794
183 Ga0055540_1037751
184 Ga0055531_10011199
185 Ga0055543_1000247
186 Ga0065165_1000047
187 Ga0065714_10287357
188 Ga0065712_10112959
189 Ga0065715_10179766
190 Ga0070690_100458601
191 Ga0070692_10529927
192 Ga0070668_100287508
193 Ga0070675_101487298
194 Ga0070671_100597630
195 Ga0070673_100742597
196 Ga0070667_100702255
197 Ga0070711_100041471
198 Ga0070707_100090842
199 Ga0070679_101250062
200 Ga0070679_101301864
201 Ga0070684_100585333
202 Ga0070665_100244083
203 Ga0070704_101171087
204 Ga0068855_100008020
205 Ga0068856_100033148
206 Ga0068852_100605627
207 Ga0068851_10434250
208 Ga0068863_100756160
209 Ga0068858_100645842
210 Ga0068858_101181825
211 Ga0075365_10059608
212 Ga0075364_10389570
213 Ga0075364_10473801
214 Ga0070715_10096562
215 Ga0070712_100495350
216 Ga0075362_10266822
217 Ga0068871_101362289
218 Ga0068865_101608054
219 Ga0099794_10066295
220 Ga0105240_10017650
221 Ga0111539_10000100
222 Ga0105241_10713444
223 Ga0105238_12538271
224 Ga0105238_12632567
225 Ga0105239_10050707
226 Ga0157369_10363261
227 Ga0171463_1001
228 Ga0163162_12088540
229 Ga0183365_10498
230 Ga0183363_1069
231 Ga0209436_105616
232 Ga0209565_1053947
233 Ga0209673_1035726
234 Ga0209130_1000005
235 Ga0209676_1001886
236 Ga0209025_1001809
237 Ga0209025_1037413
238 Ga0209025_1110776
239 Ga0209564_1000113
240 Ga0209050_1001845
241 Ga0209256_1000779
242 Ga0209256_1006466
243 Ga0207426_1000015
244 Ga0209051_1061763
245 Ga0209257_1005154
246 Ga0207656_10333010
247 Ga0207705_11348237
248 Ga0207693_10273593
249 Ga0207663_10085242
250 Ga0207660_10985302
251 Ga0207657_10971989
252 Ga0207652_10093648
253 Ga0207646_10085747
254 Ga0207659_11618049
255 Ga0207664_10416155
256 Ga0207689_11316381
257 Ga0207667_10000429
258 Ga0207658_11652487
259 Ga0207702_10028529
260 Ga0207698_10890571
261 Ga0207698_12318280
262 Ga0209588_1118490
263 Ga0207428_10003169
264 Ga0268266_10470286
265 Ga0268264_11103383
266 Ga0265338_10076759
267 Ga0307513_10850774
268 Ga0307408_100076074
269 Ga0307408_100143963
270 Ga0307410_10233474
271 Ga0307406_11005471
272 Ga0307409_100354691
273 Ga0307409_101058188
274 Ga0307416_102174857
275 Ga0373931_0740610
276 Ga0439439_0021052
277 Ga0439447_102121
278 Ga0439466_0151548
279 Ga0451793_0276976
280 Ga0451807_2032592
281 Ga0439433_0161108
282 Ga0439452_071001
283 Ga0450918_005656
284 Ga0495638_0000273
285 Ga0495638_0158318
286 Ga0495633_0096923
287 Ga0495625_0000451
288 Ga0495588_0047730
289 Ga0495670_0015906
290 Ga0495581_0065957
291 Ga0495686_0044732
292 Ga0495686_0584985
293 Ga0496109_1233670
294 Ga0496111_0192850
295 Ga0496112_0218891
296 Ga0496117_0066879
297 Ga0496118_0170125
298 Ga0496122_0027777
299 Ga0496124_0972935
300 Ga0501033_0060612
301 Ga0501034_0089370
302 Ga0501034_0791961
303 Ga0501047_1326998
304 Ga0501076_1217127
305 Ga0501080_0494930
306 nmdc:mga03683_253506_c1
307 nmdc:mga03683_656122_c1
308 nmdc:mga00v17_380622_c1
309 nmdc:mga00v17_466802_c1
310 nmdc:mga0yw44_207203_c1
311 nmdc:mga0yw44_48592_c1
312 nmdc:mga08y16_62_c1
313 nmdc:mga0a205_672481_c1
314 Ga0500644_0237490
315 Ga0500654_129194
316 Ga0500562_026780
317 Ga0500572_000358
318 Ga0500658_0006543
319 Ga0500568_0000474
320 Ga0500588_0000024
321 Ga0500604_0032128
322 Ga0500616_0012360
323 Ga0500616_0013392
324 Ga0500616_0228870
325 Ga0500634_0000031
326 Ga0500609_042598
327 2585165241
328 2585266542
329 2585387558
330 2585394164
331 2600195230
332 2643805738
333 2644046904
334 2644065913
335 2644203657
336 2644380218
337 2644417244
338 2644450640
339 2644479693
340 2644497232
341 2644692935
342 2920822786
343 2941504071
344 8054003403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7txo-assembly1.cif.gz_A selenomethionine labeled structure of rext 0.9308 15 84
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9136 24 81
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9077 13 94
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.907 13 88
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9008 12 97
ID Description Score Start End Superfamily
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 11 88 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9136 24 81 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8983 14 100 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.896 9 88 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8955 21 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D5LWB7-F1-model_v4 deleted 0.9848 12 93
AF-A0A073IVR2-F1-model_v4 ArsR family transcriptional regulator 0.9831 14 93 GO:0003700
AF-D9SPH8-F1-model_v4 Transcriptional regulator, ArsR family 0.9815 13 88 GO:0003700
AF-A0A0U9I3N8-F1-model_v4 ArsR family transcriptional regulator 0.9806 13 94 GO:0003700
AF-A0A485LVT1-F1-model_v4 Arsenical resistance operon repressor 0.974 12 87 GO:0003700

Map