F261679

General Info

Members Datasets Scaffolds Average Seq Length
172 130 113 263

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367653|2739602676
Length 298
Sequence DDVRKTFFAGTVNERVALNGVSLTVNEGDFVTVIGSNGAGKSTLLNTVSGTIIPDSGEIRVGERVVTRLPEHRKAKWISRVFQDPMKGSSPTLTIEQNMAIAQRRGRSRGLSRGVTRARREEFRKELATLELGLENRLGAKVGLLSGGQRQALSLLMATFSAPEILLLDEHTAALDPQRAQHVTEITERIVNERHLTTLMVTHNMEQALRLGNRLIMMHEGRILFELDAQQKAEATVADLLAEFRKLQAATGEPALDDATLLETARSAAPSAAPSRGVPAGGAPTGGSSAAEVAPEGQ

Samples

Sample ID Description Type Environment
1 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
2 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
3 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
4 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
5 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
6 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
7 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
8 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
9 2643221546 Microbacterium sp. Root53 Isolate Unclassified
10 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
11 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
12 2739367653 Kocuria sp. OV113 Isolate Unclassified
13 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
14 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
15 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
16 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
17 2818991459 Paenibacillus sp. 597 Isolate Unclassified
18 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
19 2854911287 Brucella lupini LUP21 Isolate Unclassified
20 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
21 2857472729 Cohnella sp. R-74144 Isolate Unclassified
22 2857727296 Kocuria sp. R-72562 Isolate Unclassified
23 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
24 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
25 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
26 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
27 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
28 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
29 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
30 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
31 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
32 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
33 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
34 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
35 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
36 2920879853 Kocuria salina CV6 Isolate Unclassified
37 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
38 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
39 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
40 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
41 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
42 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
43 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
44 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
45 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
46 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
47 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
48 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
49 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
50 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
51 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
90 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
91 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
95 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
96 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
125 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
126 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
127 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
128 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
129 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
130 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 65.12
Metatranscriptomes 0.58
Isolates 34.3

Biome Distribution

Category Percentage (%)
Aerial Root 1.16
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 1.16
Rhizosphere 55.23
Stem 0
Stem Tuber 0
Unclassified 39.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10150644 3300005289 Bacteria 1432
2 Ga0070711_100173754 3300005439 Bacteria 1644
3 Ga0070708_100266317 3300005445 Bacteria 1611
4 Ga0070706_100219837 3300005467 Bacteria 1773
5 Ga0070699_100631559 3300005518 Bacteria 977
6 Ga0070665_100001100 3300005548 Bacteria 33366
7 Ga0070716_100061314 3300006173 Bacteria 2176
8 Ga0070712_100044228 3300006175 Bacteria 3070
9 Ga0075433_10343114 3300006852 Bacteria 1320
10 Ga0075434_100161829 3300006871 Bacteria 2258
11 Ga0105244_10078819 3300009036 Bacteria 1633
12 Ga0105241_10021200 3300009174 Bacteria 4802
13 Ga0105246_10007070 3300011119 Bacteria 6870
14 Ga0157378_10003961 3300013297 Bacteria 13084
15 Ga0163162_10350775 3300013306 Bacteria 1608
16 Ga0157375_10179595 3300013308 Bacteria 2268
17 Ga0213875_10126080 3300021388 Bacteria 1196
18 Ga0209784_100037 3300025224 Bacteria 259956
19 Ga0209566_100046 3300025225 Bacteria 247053
20 Ga0209437_100604 3300025233 Bacteria 22343
21 Ga0209025_1050132 3300025294 Bacteria 1672
22 Ga0209025_1051618 3300025294 Bacteria 1632
23 Ga0207655_1024426 3300025728 Bacteria 2962
24 Ga0207655_1100581 3300025728 Bacteria 997
25 Ga0207693_10073215 3300025915 Bacteria 2682
26 Ga0207665_10063908 3300025939 Bacteria 2500
27 Ga0307408_100160092 3300031548 Bacteria 1787
28 Ga0316576_10001332 3300031727 Bacteria 13125
29 Ga0316576_10002440 3300031727 Bacteria 10575
30 Ga0316576_10072845 3300031727 Bacteria 2537
31 Ga0316576_10099446 3300031727 Bacteria 2173
32 Ga0316576_10209405 3300031727 Bacteria 1468
33 Ga0316576_10472522 3300031727 Bacteria 924
34 Ga0316578_10003947 3300031728 Bacteria 6909
35 Ga0307405_10311211 3300031731 Bacteria 1199
36 Ga0307410_10068793 3300031852 Bacteria 2447
37 Ga0307410_10234997 3300031852 Bacteria 1417
38 Ga0307406_10092526 3300031901 Bacteria 2039
39 Ga0307409_100052296 3300031995 Bacteria 3130
40 Ga0307409_100066728 3300031995 Bacteria 2838
41 Ga0307409_100177879 3300031995 Bacteria 1880
42 Ga0307416_100026123 3300032002 Bacteria 4296
43 Ga0373962_0069850 3300035242 Bacteria 1048
44 Ga0316574_0080321 3300035398 Bacteria 2069
45 Ga0373947_0010732 3300035725 Bacteria 5258
46 Ga0316582_0145609 3300036647 Bacteria 1599
47 Ga0316584_0011314 3300036712 Bacteria 6266
48 Ga0316584_0064828 3300036712 Bacteria 2736
49 Ga0400484_22182 3300038725 Bacteria 7690
50 Ga0400484_23782 3300038725 Bacteria 7387
51 Ga0400490_39460 3300038726 Bacteria 3929
52 Ga0400491_13725 3300038727 Bacteria 3361
53 Ga0400488_55197 3300038741 Bacteria 1048
54 Ga0400483_060835 3300039062 Bacteria 6144
55 Ga0400483_178423 3300039062 Bacteria 7644
56 Ga0400483_187620 3300039062 Bacteria 2600
57 Ga0400483_215564 3300039062 Bacteria 2560
58 Ga0400489_53516 3300039093 Bacteria 8602
59 Ga0400489_80565 3300039093 Bacteria 21621
60 Ga0439433_0009018 3300041999 Bacteria 2172
61 Ga0439449_0000074 3300042007 Bacteria 31794
62 Ga0439449_0010015 3300042007 Bacteria 3586
63 Ga0439462_0000368 3300042015 Bacteria 8612
64 Ga0451577_0009942 3300042876 Bacteria 9120
65 Ga0451577_0011175 3300042876 Bacteria 8517
66 Ga0453684_0005909 3300044712 Bacteria 23733
67 Ga0453684_0008353 3300044712 Bacteria 18601
68 Ga0453684_0009618 3300044712 Bacteria 16858
69 Ga0453684_0454838 3300044712 Bacteria 1424
70 Ga0495641_0141258 3300046461 Bacteria 1076
71 Ga0495605_0038211 3300046474 Bacteria 2410
72 Ga0495666_0099504 3300046526 Bacteria 1370
73 Ga0495634_0007039 3300046642 Bacteria 8484
74 Ga0495661_0177700 3300046665 Bacteria 1130
75 Ga0495658_0231746 3300046683 Bacteria 1158
76 Ga0495613_0045782 3300046689 Bacteria 3235
77 Ga0495660_0145889 3300046810 Bacteria 1173
78 Ga0495674_0099138 3300047319 Bacteria 2481
79 Ga0496111_0120397 3300048914 Bacteria 1939
80 Ga0496116_0001198 3300048919 Bacteria 30437
81 Ga0496116_0001391 3300048919 Bacteria 27220
82 Ga0496116_0003718 3300048919 Bacteria 14921
83 Ga0496117_0003002 3300048920 Bacteria 20297
84 Ga0496118_0027821 3300048921 Bacteria 4775
85 Ga0496119_0005315 3300048922 Bacteria 12392
86 Ga0496119_0007183 3300048922 Bacteria 10092
87 Ga0496119_0015805 3300048922 Bacteria 5781
88 Ga0496119_0047544 3300048922 Bacteria 2668
89 Ga0496120_0000012 3300048923 Bacteria 348703
90 Ga0496120_0000020 3300048923 Bacteria 259925
91 Ga0496121_0054328 3300048924 Bacteria 3348
92 Ga0496121_0368132 3300048924 Bacteria 952
93 Ga0496122_0000011 3300048925 Bacteria 545274
94 Ga0496122_0017356 3300048925 Bacteria 6736
95 Ga0496122_0046670 3300048925 Bacteria 3352
96 Ga0496122_0072387 3300048925 Bacteria 2451
97 Ga0496122_0155962 3300048925 Bacteria 1401
98 Ga0496123_0000223 3300048926 Bacteria 115404
99 Ga0496123_0049165 3300048926 Bacteria 2830
100 Ga0496123_0074900 3300048926 Bacteria 2092
101 Ga0496124_0001155 3300048927 Bacteria 41411
102 Ga0496124_0012945 3300048927 Bacteria 8182
103 Ga0496124_0321604 3300048927 Bacteria 1107
104 Ga0496125_0000004 3300048928 Bacteria 843089
105 Ga0496125_0001389 3300048928 Bacteria 35441
106 Ga0496125_0046705 3300048928 Bacteria 3630
107 Ga0496126_0000002 3300048929 Bacteria 1001703
108 Ga0496126_0000121 3300048929 Bacteria 183205
109 Ga0496126_0000171 3300048929 Bacteria 148394
110 Ga0496126_0547225 3300048929 Bacteria 919
111 Ga0501321_013800 3300049537 Bacteria 933
112 Ga0501031_0030391 3300049568 Bacteria 3523
113 Ga0495655_0001048 3300053083 Bacteria 4265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100161829 Ga0075434_1001618292 232
2 3300048914 Ga0496111_0120397 Ga0496111_0120397_426_1223 246
3 3300031852 Ga0307410_10234997 Ga0307410_102349971 248
4 3300031995 Ga0307409_100052296 Ga0307409_1000522962 248
5 3300048925 Ga0496122_0017356 Ga0496122_0017356_3148_3942 249
6 3300048926 Ga0496123_0074900 Ga0496123_0074900_252_1046 252
7 3300044712 Ga0453684_0454838 Ga0453684_0454838_589_1383 253
8 3300009036 Ga0105244_10078819 Ga0105244_100788192 254
9 3300011119 Ga0105246_10007070 Ga0105246_100070705 254
10 3300025233 Ga0209437_100604 Ga0209437_10060410 254
11 3300025728 Ga0207655_1024426 Ga0207655_10244263 254
12 3300025728 Ga0207655_1100581 Ga0207655_11005811 254
13 3300048919 Ga0496116_0001391 Ga0496116_0001391_10797_11591 254
14 3300048924 Ga0496121_0054328 Ga0496121_0054328_502_1296 254
15 3300048924 Ga0496121_0368132 Ga0496121_0368132_66_860 254
16 3300048925 Ga0496122_0072387 Ga0496122_0072387_872_1666 254
17 3300048927 Ga0496124_0012945 Ga0496124_0012945_4016_4810 254
18 3300048928 Ga0496125_0046705 Ga0496125_0046705_952_1746 254
19 3300031727 Ga0316576_10002440 Ga0316576_100024407 259
20 3300031727 Ga0316576_10072845 Ga0316576_100728453 259
21 3300031727 Ga0316576_10099446 Ga0316576_100994462 259
22 3300031727 Ga0316576_10209405 Ga0316576_102094052 259
23 3300038725 Ga0400484_22182 Ga0400484_22182_2041_2820 259
24 3300038726 Ga0400490_39460 Ga0400490_39460_26_808 259
25 3300038741 Ga0400488_55197 Ga0400488_55197_156_935 259
26 3300039062 Ga0400483_060835 Ga0400483_060835_4755_5534 259
27 3300039062 Ga0400483_178423 Ga0400483_178423_2525_3304 259
28 3300039093 Ga0400489_53516 Ga0400489_53516_4330_5109 259
29 3300039093 Ga0400489_80565 Ga0400489_80565_5230_6015 259
30 iso_pu_bacteria 2643221546 2643752470 259
31 iso_pu_bacteria 2758568016 2758642925 259
32 iso_pu_bacteria 2854911287 2854913696 259
33 iso_pu_bacteria 2915650412 2915650584 259
34 iso_pu_bacteria 2932398195 2932400977 259
35 iso_pu_bacteria 8055037949 8055040246 259
36 iso_pu_bacteria 8055037949 8055040279 259
37 iso_pu_bacteria 2523533628 2524001002 260
38 iso_pu_bacteria 2571042588 2573039032 260
39 iso_pu_bacteria 2576861424 2578336794 260
40 iso_pu_bacteria 2579778775 2580932167 260
41 iso_pu_bacteria 2585428059 2587742276 260
42 iso_pu_bacteria 2600255286 2601638308 260
43 iso_pu_bacteria 2619619294 2621275003 260
44 iso_pu_bacteria 2643221543 2643740590 260
45 iso_pu_bacteria 2643221676 2644425604 260
46 iso_pu_bacteria 2728368933 2728532560 260
47 iso_pu_bacteria 2739367653 2739602676 260
48 iso_pu_bacteria 2740891818 2740991725 260
49 iso_pu_bacteria 2791355222 2793182077 260
50 iso_pu_bacteria 2816332305 2817508850 260
51 iso_pu_bacteria 2818991459 2819674228 260
52 iso_pu_bacteria 2821111986 2821116493 260
53 iso_pu_bacteria 2857453340 2857458449 260
54 iso_pu_bacteria 2857472729 2857476917 260
55 iso_pu_bacteria 2857727296 2857728559 260
56 iso_pu_bacteria 2864733723 2864734562 260
57 iso_pu_bacteria 2881636855 2881637948 260
58 iso_pu_bacteria 2885526491 2885532919 260
59 iso_pu_bacteria 2889042446 2889048398 260
60 iso_pu_bacteria 2889790730 2889795219 260
61 iso_pu_bacteria 2889914905 2889918732 260
62 iso_pu_bacteria 2904162308 2904167744 260
63 iso_pu_bacteria 2904490793 2904494657 260
64 iso_pu_bacteria 2904755435 2904762561 260
65 iso_pu_bacteria 2907202186 2907203505 260
66 iso_pu_bacteria 2919160200 2919164216 260
67 iso_pu_bacteria 2919425241 2919430488 260
68 iso_pu_bacteria 2920879853 2920882208 260
69 iso_pu_bacteria 2931384279 2931385511 260
70 iso_pu_bacteria 2938649242 2938649755 260
71 iso_pu_bacteria 2939679117 2939680314 260
72 iso_pu_bacteria 2945991243 2945995854 260
73 iso_pu_bacteria 2946053406 2946058562 260
74 iso_pu_bacteria 2968558590 2968563979 260
75 iso_pu_bacteria 2971403814 2971405797 260
76 iso_pu_bacteria 2971410472 2971416806 260
77 iso_pu_bacteria 2971511577 2971515553 260
78 iso_pu_bacteria 2980176882 2980180056 260
79 iso_pu_bacteria 2984527788 2984530225 260
80 iso_pu_bacteria 2984532647 2984536334 260
81 iso_pu_bacteria 2988225383 2988229319 260
82 iso_pu_bacteria 2996632988 2996639086 260
83 iso_pu_bacteria 8002811521 8002812177 260
84 iso_pu_bacteria 8007375930 8007377660 260
85 iso_pu_bacteria 8054465665 8054467989 260
86 iso_pu_bacteria 8055632911 8055635857 260
87 iso_pu_bacteria 8056533031 8056537957 260
88 iso_pu_bacteria 8057473075 8057473387 260
89 3300053083 Ga0495655_0001048 Ga0495655_0001048_2300_3088 262
90 3300005439 Ga0070711_100173754 Ga0070711_1001737542 263
91 3300006175 Ga0070712_100044228 Ga0070712_1000442282 263
92 3300009174 Ga0105241_10021200 Ga0105241_100212004 263
93 3300025915 Ga0207693_10073215 Ga0207693_100732153 263
94 3300031548 Ga0307408_100160092 Ga0307408_1001600922 263
95 3300031731 Ga0307405_10311211 Ga0307405_103112112 263
96 3300031901 Ga0307406_10092526 Ga0307406_100925262 263
97 3300031995 Ga0307409_100066728 Ga0307409_1000667283 263
98 3300032002 Ga0307416_100026123 Ga0307416_1000261232 263
99 3300035725 Ga0373947_0010732 Ga0373947_0010732_1866_2669 263
100 3300046461 Ga0495641_0141258 Ga0495641_0141258_231_1034 263
101 3300046526 Ga0495666_0099504 Ga0495666_0099504_106_909 263
102 3300046642 Ga0495634_0007039 Ga0495634_0007039_6299_7102 263
103 3300046683 Ga0495658_0231746 Ga0495658_0231746_33_836 263
104 3300046689 Ga0495613_0045782 Ga0495613_0045782_1040_1843 263
105 3300047319 Ga0495674_0099138 Ga0495674_0099138_670_1473 263
106 3300048922 Ga0496119_0047544 Ga0496119_0047544_991_1785 263
107 3300048925 Ga0496122_0155962 Ga0496122_0155962_595_1386 263
108 3300049537 Ga0501321_013800 Ga0501321_013800_100_891 263
109 3300005289 Ga0065704_10150644 Ga0065704_101506441 264
110 3300005445 Ga0070708_100266317 Ga0070708_1002663171 264
111 3300005467 Ga0070706_100219837 Ga0070706_1002198372 264
112 3300005518 Ga0070699_100631559 Ga0070699_1006315591 264
113 3300005548 Ga0070665_100001100 Ga0070665_10000110016 264
114 3300006173 Ga0070716_100061314 Ga0070716_1000613141 264
115 3300006852 Ga0075433_10343114 Ga0075433_103431141 264
116 3300013297 Ga0157378_10003961 Ga0157378_100039619 264
117 3300013306 Ga0163162_10350775 Ga0163162_103507752 264
118 3300013308 Ga0157375_10179595 Ga0157375_101795952 264
119 3300021388 Ga0213875_10126080 Ga0213875_101260802 264
120 3300025224 Ga0209784_100037 Ga0209784_10003744 264
121 3300025225 Ga0209566_100046 Ga0209566_100046140 264
122 3300025294 Ga0209025_1050132 Ga0209025_10501323 264
123 3300025294 Ga0209025_1051618 Ga0209025_10516182 264
124 3300025939 Ga0207665_10063908 Ga0207665_100639083 264
125 3300031727 Ga0316576_10001332 Ga0316576_100013323 264
126 3300031727 Ga0316576_10472522 Ga0316576_104725221 264
127 3300031728 Ga0316578_10003947 Ga0316578_100039474 264
128 3300031852 Ga0307410_10068793 Ga0307410_100687932 264
129 3300031995 Ga0307409_100177879 Ga0307409_1001778792 264
130 3300035242 Ga0373962_0069850 Ga0373962_0069850_218_1030 264
131 3300035398 Ga0316574_0080321 Ga0316574_0080321_418_1212 264
132 3300036647 Ga0316582_0145609 Ga0316582_0145609_117_911 264
133 3300036712 Ga0316584_0011314 Ga0316584_0011314_2134_2928 264
134 3300036712 Ga0316584_0064828 Ga0316584_0064828_42_836 264
135 3300038725 Ga0400484_23782 Ga0400484_23782_4466_5260 264
136 3300038727 Ga0400491_13725 Ga0400491_13725_2147_2941 264
137 3300039062 Ga0400483_187620 Ga0400483_187620_134_928 264
138 3300039062 Ga0400483_215564 Ga0400483_215564_1194_1988 264
139 3300041999 Ga0439433_0009018 Ga0439433_0009018_575_1372 264
140 3300042007 Ga0439449_0000074 Ga0439449_0000074_26616_27410 264
141 3300042007 Ga0439449_0010015 Ga0439449_0010015_1731_2528 264
142 3300042015 Ga0439462_0000368 Ga0439462_0000368_4408_5205 264
143 3300042876 Ga0451577_0009942 Ga0451577_0009942_1995_2807 264
144 3300042876 Ga0451577_0011175 Ga0451577_0011175_1194_2006 264
145 3300044712 Ga0453684_0005909 Ga0453684_0005909_1421_2215 264
146 3300044712 Ga0453684_0008353 Ga0453684_0008353_10392_11204 264
147 3300044712 Ga0453684_0009618 Ga0453684_0009618_128_940 264
148 3300046474 Ga0495605_0038211 Ga0495605_0038211_223_1017 264
149 3300046665 Ga0495661_0177700 Ga0495661_0177700_51_845 264
150 3300046810 Ga0495660_0145889 Ga0495660_0145889_194_988 264
151 3300048919 Ga0496116_0001198 Ga0496116_0001198_22880_23683 264
152 3300048919 Ga0496116_0003718 Ga0496116_0003718_6759_7562 264
153 3300048920 Ga0496117_0003002 Ga0496117_0003002_14788_15585 264
154 3300048921 Ga0496118_0027821 Ga0496118_0027821_2435_3232 264
155 3300048922 Ga0496119_0005315 Ga0496119_0005315_6767_7570 264
156 3300048922 Ga0496119_0007183 Ga0496119_0007183_6801_7604 264
157 3300048922 Ga0496119_0015805 Ga0496119_0015805_1943_2746 264
158 3300048923 Ga0496120_0000012 Ga0496120_0000012_14649_15452 264
159 3300048923 Ga0496120_0000020 Ga0496120_0000020_98933_99736 264
160 3300048925 Ga0496122_0000011 Ga0496122_0000011_171727_172524 264
161 3300048925 Ga0496122_0046670 Ga0496122_0046670_1492_2295 264
162 3300048926 Ga0496123_0000223 Ga0496123_0000223_1058_1861 264
163 3300048926 Ga0496123_0049165 Ga0496123_0049165_1132_1929 264
164 3300048927 Ga0496124_0001155 Ga0496124_0001155_25657_26451 264
165 3300048927 Ga0496124_0321604 Ga0496124_0321604_67_870 264
166 3300048928 Ga0496125_0000004 Ga0496125_0000004_228629_229432 264
167 3300048928 Ga0496125_0001389 Ga0496125_0001389_26702_27496 264
168 3300048929 Ga0496126_0000002 Ga0496126_0000002_519411_520208 264
169 3300048929 Ga0496126_0000121 Ga0496126_0000121_58028_58822 264
170 3300048929 Ga0496126_0000171 Ga0496126_0000171_39181_39978 264
171 3300048929 Ga0496126_0547225 Ga0496126_0547225_78_881 264
172 3300049568 Ga0501031_0030391 Ga0501031_0030391_645_1442 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9351 2 232
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9283 2 232
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9245 2 232
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9233 2 232
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.919 2 238
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 2 231 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 2 232 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9202 2 232 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9056 2 231 3.40.50.300
af_P77509_259_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9054 2 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X7BUJ3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9707 1 248 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A151AUE1-F1-model_v4 Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) 0.9654 82 264 GO:0005524
GO:0016887
AF-A0A7L9RRY7-F1-model_v4 Ferric enterobactin transport ATP-binding protein FepC 0.9577 1 252 GO:0005524
GO:0016887
AF-A0A7X7BUJ3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9556 1 248 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A151AUE1-F1-model_v4 Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) 0.9451 82 264 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.57 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map