F262273

General Info

Members Datasets Scaffolds Average Seq Length
173 118 346 208

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100025845|Ga0068855_1000258455
Length 226
Sequence MYFFSATEKMAVGVQYIEMALILTALGVFIILLASELWWRYKNPQSELSRKFVHITVGTFVAFWPFFLNWNQIRLLALGFAVTVVVSKTFHIFRAIHSVQRPTWGEVYFALVVGLLTFVTHSKSIYAASLLQMSLADGLAAVVGVRFGKRHRYKVLGHPKSYLGTATFLVVSVLLLVGYIVTGHDLAVSHLIGLAILASLGENFGVAGLDNLFVPLLVALVLTKIG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
114 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
115 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
116 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
117 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.23
Nodule 0
Rhizoplane 1.16
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100025845 3300005563 Bacteria 7022
2 JGI24741J21665_1004084 3300001915 Bacteria 3313
3 JGI24740J21852_10003850 3300001979 Bacteria 6513
4 JGI24737J22298_10000010 3300001990 Bacteria 55828
5 JGI24735J21928_10000052 3300002067 Bacteria 50482
6 rootH2_10118052 3300003320 Bacteria 1087
7 rootH1_10237707 3300003323 Bacteria 1302
8 Ga0070658_10000110 3300005327 Bacteria 73137
9 Ga0070658_10003611 3300005327 Bacteria 12676
10 Ga0070680_100054292 3300005336 Bacteria 3271
11 Ga0070660_100014556 3300005339 Bacteria 5672
12 Ga0070660_100662546 3300005339 Unclassified 874
13 Ga0070674_100000920 3300005356 Bacteria 15341
14 Ga0070674_100038701 3300005356 Bacteria 3216
15 Ga0070673_100000135 3300005364 Bacteria 35068
16 Ga0070688_100406794 3300005365 Bacteria 1008
17 Ga0070678_100023024 3300005456 Bacteria 4143
18 Ga0068867_100008149 3300005459 Bacteria 7403
19 Ga0070685_10000153 3300005466 Bacteria 45555
20 Ga0070679_100009863 3300005530 Bacteria 9035
21 Ga0070679_100038240 3300005530 Bacteria 4770
22 Ga0070679_100623251 3300005530 Bacteria 1022
23 Ga0068853_100010610 3300005539 Bacteria 7453
24 Ga0070665_100089540 3300005548 Bacteria 3083
25 Ga0070665_100126568 3300005548 Bacteria 2557
26 Ga0068855_100000001 3300005563 Bacteria 818777
27 Ga0068855_100001696 3300005563 Bacteria 27546
28 Ga0068857_100019314 3300005577 Bacteria 5983
29 Ga0068856_100000002 3300005614 Bacteria 372816
30 Ga0068856_100029459 3300005614 Bacteria 5362
31 Ga0081455_10000008 3300005937 Bacteria 256558
32 Ga0075365_10023480 3300006038 Bacteria 3880
33 Ga0075365_10386897 3300006038 Unclassified 987
34 Ga0075368_10003024 3300006042 Bacteria 5560
35 Ga0075364_10014289 3300006051 Unclassified 4904
36 Ga0075364_10014372 3300006051 Bacteria 4891
37 Ga0075367_10000064 3300006178 Bacteria 26426
38 Ga0075366_10000007 3300006195 Bacteria 104412
39 Ga0075366_10000390 3300006195 Bacteria 20368
40 Ga0068871_100104069 3300006358 Bacteria 2381
41 Ga0068865_100021905 3300006881 Bacteria 4161
42 Ga0068865_100252964 3300006881 Unclassified 1391
43 Ga0105240_10000003 3300009093 Bacteria 1183681
44 Ga0105245_10000034 3300009098 Bacteria 147951
45 Ga0105245_10003608 3300009098 Bacteria 13810
46 Ga0105243_10000001 3300009148 Bacteria 1156578
47 Ga0105241_10000003 3300009174 Bacteria 839043
48 Ga0105242_10000001 3300009176 Bacteria 574039
49 Ga0105237_10017776 3300009545 Bacteria 7372
50 Ga0105237_10493770 3300009545 Bacteria 1231
51 Ga0105237_10647794 3300009545 Unclassified 1063
52 Ga0105033_100115 3300009986 Bacteria 6148
53 Ga0105028_100260 3300009993 Bacteria 5760
54 Ga0105239_10016426 3300010375 Bacteria 8184
55 Ga0105239_10061147 3300010375 Bacteria 4134
56 Ga0105239_11291569 3300010375 Unclassified 842
57 Ga0157373_10013501 3300013100 Bacteria 5989
58 Ga0157369_10000054 3300013105 Bacteria 162631
59 Ga0157369_10401184 3300013105 Bacteria 1422
60 Ga0157374_10001007 3300013296 Bacteria 24406
61 Ga0157374_10109096 3300013296 Bacteria 2661
62 Ga0157378_10092108 3300013297 Bacteria 2757
63 Ga0157372_10009002 3300013307 Bacteria 10613
64 Ga0157375_10490715 3300013308 Bacteria 1393
65 Ga0157375_10601917 3300013308 Bacteria 1258
66 Ga0163163_11307106 3300014325 Bacteria 787
67 Ga0157380_10312336 3300014326 Unclassified 1453
68 Ga0157377_10007925 3300014745 Bacteria 5157
69 Ga0157376_10000001 3300014969 Bacteria 842910
70 Ga0207647_10423664 3300025904 Unclassified 748
71 Ga0207705_10002683 3300025909 Bacteria 13630
72 Ga0207705_10004076 3300025909 Bacteria 11089
73 Ga0207654_10000002 3300025911 Bacteria 1460142
74 Ga0207707_10023891 3300025912 Bacteria 5345
75 Ga0207695_10000005 3300025913 Bacteria 1196715
76 Ga0207671_10008360 3300025914 Bacteria 8787
77 Ga0207671_10309742 3300025914 Bacteria 1248
78 Ga0207660_10001720 3300025917 Bacteria 14673
79 Ga0207660_10209761 3300025917 Bacteria 1525
80 Ga0207657_10005411 3300025919 Bacteria 13348
81 Ga0207652_10002857 3300025921 Bacteria 14455
82 Ga0207652_10005234 3300025921 Bacteria 10544
83 Ga0207652_10014032 3300025921 Bacteria 6486
84 Ga0207652_10696049 3300025921 Unclassified 907
85 Ga0207694_10225564 3300025924 Bacteria 1529
86 Ga0207687_10000365 3300025927 Bacteria 30197
87 Ga0207687_10006750 3300025927 Bacteria 7563
88 Ga0207686_10000001 3300025934 Bacteria 1169580
89 Ga0207686_10130331 3300025934 Bacteria 1724
90 Ga0207709_10000002 3300025935 Bacteria 1171536
91 Ga0207669_10003540 3300025937 Bacteria 6761
92 Ga0207669_10160053 3300025937 Bacteria 1589
93 Ga0207667_10000003 3300025949 Bacteria 822935
94 Ga0207667_10077997 3300025949 Bacteria 3434
95 Ga0207651_10000161 3300025960 Bacteria 28725
96 Ga0207639_10057419 3300026041 Bacteria 2988
97 Ga0207702_10000001 3300026078 Bacteria 895738
98 Ga0207702_10212926 3300026078 Bacteria 1797
99 Ga0207648_10107514 3300026089 Bacteria 2448
100 Ga0207674_10010396 3300026116 Bacteria 10545
101 Ga0207683_10002915 3300026121 Bacteria 14921
102 Ga0209813_10001309 3300027866 Bacteria 5560
103 Ga0207428_10039913 3300027907 Bacteria 3810
104 Ga0268266_10000662 3300028379 Bacteria 46629
105 Ga0268266_10067525 3300028379 Bacteria 3095
106 Ga0265328_10054128 3300031239 Bacteria 1472
107 Ga0395899_0004205 3300037312 Bacteria 11292
108 Ga0395899_0004429 3300037312 Bacteria 10954
109 Ga0395900_0000712 3300037418 Bacteria 44237
110 Ga0395900_0020741 3300037418 Bacteria 6716
111 Ga0395900_0076796 3300037418 Bacteria 3432
112 Ga0395900_0160164 3300037418 Bacteria 2296
113 Ga0395900_0354632 3300037418 Bacteria 1440
114 Ga0395900_0371288 3300037418 Bacteria 1400
115 Ga0395898_0003669 3300037466 Bacteria 17057
116 Ga0395898_0039881 3300037466 Bacteria 4646
117 Ga0395898_0463892 3300037466 Bacteria 1206
118 Ga0395898_0705951 3300037466 Bacteria 950
119 Ga0395905_0000943 3300037471 Bacteria 37400
120 Ga0395905_0179759 3300037471 Bacteria 1986
121 Ga0395905_0411271 3300037471 Bacteria 1248
122 Ga0395901_0004150 3300038443 Bacteria 14616
123 Ga0395901_0008932 3300038443 Bacteria 10149
124 Ga0395901_0011341 3300038443 Bacteria 9031
125 Ga0395901_0299671 3300038443 Bacteria 1667
126 Ga0395901_0364513 3300038443 Bacteria 1489
127 Ga0466963_0227484 3300044694 Bacteria 1307
128 Ga0495649_0000100 3300046694 Bacteria 75606
129 Ga0495686_0158553 3300047472 Bacteria 1324
130 Ga0496109_0150534 3300048912 Unclassified 2178
131 Ga0496112_0119686 3300048915 Bacteria 2603
132 Ga0501031_0001813 3300049568 Bacteria 13426
133 Ga0501032_0001512 3300049569 Bacteria 18574
134 Ga0501034_0018818 3300049571 Bacteria 7079
135 Ga0501036_0010730 3300049572 Bacteria 7574
136 Ga0501037_0000138 3300049573 Bacteria 68040
137 Ga0501038_0084468 3300049574 Bacteria 2671
138 Ga0501043_0000062 3300049579 Bacteria 95664
139 Ga0501046_0000059 3300049580 Bacteria 126801
140 Ga0501047_0000032 3300049581 Bacteria 208294
141 Ga0501048_0015216 3300049582 Bacteria 5683
142 Ga0501069_0024818 3300049585 Bacteria 3273
143 Ga0501070_0036147 3300049586 Bacteria 4125
144 Ga0501083_0058577 3300049744 Bacteria 2577
145 Ga0501035_0001735 3300049822 Bacteria 22038
146 Ga0501044_0012395 3300049823 Bacteria 9230
147 nmdc:mga00v17_17000_c2 3300050491 Bacteria 2061
148 nmdc:mga00v17_4078_c1 3300050491 Bacteria 7554
149 nmdc:mga0yw44_29557_c1 3300050492 Bacteria 3164
150 nmdc:mga0yw44_77707_c1 3300050492 Bacteria 2074
151 nmdc:mga0k408_1745_c1 3300050493 Bacteria 7483
152 nmdc:mga0k408_29_c1 3300050493 Bacteria 89645
153 nmdc:mga0k408_46151_c1 3300050493 Bacteria 2515
154 nmdc:mga0k408_559_c1 3300050493 Bacteria 20485
155 nmdc:mga06z11_161_c1 3300050494 Bacteria 26426
156 nmdc:mga04h51_1410_c1 3300050495 Bacteria 5560
157 Ga0500610_0151846 3300053079 Bacteria 1160
158 Ga0500644_0002149 3300053088 Bacteria 4990
159 Ga0500646_0000179 3300053090 Bacteria 18884
160 Ga0500583_0050747 3300053092 Bacteria 1925
161 Ga0500651_0000011 3300053093 Bacteria 246573
162 Ga0500651_0009086 3300053093 Bacteria 5885
163 Ga0500650_0000001 3300053098 Bacteria 818797
164 Ga0500562_000002 3300053108 Bacteria 977234
165 Ga0500562_061956 3300053108 Bacteria 1005
166 Ga0500594_0000001 3300053118 Bacteria 1178472
167 Ga0500614_009889 3300053123 Bacteria 2039
168 Ga0500655_005652 3300053133 Bacteria 2249
169 Ga0500561_0000002 3300053137 Bacteria 394147
170 Ga0500577_0007692 3300053142 Bacteria 3033
171 Ga0500579_024698 3300053143 Bacteria 3883
172 Ga0500633_0006035 3300053160 Bacteria 2938
173 Ga0501082_0056233 3300060353 Bacteria 3389
174 Ga0068855_100025845
175 JGI24741J21665_1004084
176 JGI24740J21852_10003850
177 JGI24737J22298_10000010
178 JGI24735J21928_10000052
179 rootH2_10118052
180 rootH1_10237707
181 Ga0070658_10000110
182 Ga0070658_10003611
183 Ga0070680_100054292
184 Ga0070660_100014556
185 Ga0070660_100662546
186 Ga0070674_100000920
187 Ga0070674_100038701
188 Ga0070673_100000135
189 Ga0070688_100406794
190 Ga0070678_100023024
191 Ga0068867_100008149
192 Ga0070685_10000153
193 Ga0070679_100009863
194 Ga0070679_100038240
195 Ga0070679_100623251
196 Ga0068853_100010610
197 Ga0070665_100089540
198 Ga0070665_100126568
199 Ga0068855_100000001
200 Ga0068855_100001696
201 Ga0068857_100019314
202 Ga0068856_100000002
203 Ga0068856_100029459
204 Ga0081455_10000008
205 Ga0075365_10023480
206 Ga0075365_10386897
207 Ga0075368_10003024
208 Ga0075364_10014289
209 Ga0075364_10014372
210 Ga0075367_10000064
211 Ga0075366_10000007
212 Ga0075366_10000390
213 Ga0068871_100104069
214 Ga0068865_100021905
215 Ga0068865_100252964
216 Ga0105240_10000003
217 Ga0105245_10000034
218 Ga0105245_10003608
219 Ga0105243_10000001
220 Ga0105241_10000003
221 Ga0105242_10000001
222 Ga0105237_10017776
223 Ga0105237_10493770
224 Ga0105237_10647794
225 Ga0105033_100115
226 Ga0105028_100260
227 Ga0105239_10016426
228 Ga0105239_10061147
229 Ga0105239_11291569
230 Ga0157373_10013501
231 Ga0157369_10000054
232 Ga0157369_10401184
233 Ga0157374_10001007
234 Ga0157374_10109096
235 Ga0157378_10092108
236 Ga0157372_10009002
237 Ga0157375_10490715
238 Ga0157375_10601917
239 Ga0163163_11307106
240 Ga0157380_10312336
241 Ga0157377_10007925
242 Ga0157376_10000001
243 Ga0207647_10423664
244 Ga0207705_10002683
245 Ga0207705_10004076
246 Ga0207654_10000002
247 Ga0207707_10023891
248 Ga0207695_10000005
249 Ga0207671_10008360
250 Ga0207671_10309742
251 Ga0207660_10001720
252 Ga0207660_10209761
253 Ga0207657_10005411
254 Ga0207652_10002857
255 Ga0207652_10005234
256 Ga0207652_10014032
257 Ga0207652_10696049
258 Ga0207694_10225564
259 Ga0207687_10000365
260 Ga0207687_10006750
261 Ga0207686_10000001
262 Ga0207686_10130331
263 Ga0207709_10000002
264 Ga0207669_10003540
265 Ga0207669_10160053
266 Ga0207667_10000003
267 Ga0207667_10077997
268 Ga0207651_10000161
269 Ga0207639_10057419
270 Ga0207702_10000001
271 Ga0207702_10212926
272 Ga0207648_10107514
273 Ga0207674_10010396
274 Ga0207683_10002915
275 Ga0209813_10001309
276 Ga0207428_10039913
277 Ga0268266_10000662
278 Ga0268266_10067525
279 Ga0265328_10054128
280 Ga0395899_0004205
281 Ga0395899_0004429
282 Ga0395900_0000712
283 Ga0395900_0020741
284 Ga0395900_0076796
285 Ga0395900_0160164
286 Ga0395900_0354632
287 Ga0395900_0371288
288 Ga0395898_0003669
289 Ga0395898_0039881
290 Ga0395898_0463892
291 Ga0395898_0705951
292 Ga0395905_0000943
293 Ga0395905_0179759
294 Ga0395905_0411271
295 Ga0395901_0004150
296 Ga0395901_0008932
297 Ga0395901_0011341
298 Ga0395901_0299671
299 Ga0395901_0364513
300 Ga0466963_0227484
301 Ga0495649_0000100
302 Ga0495686_0158553
303 Ga0496109_0150534
304 Ga0496112_0119686
305 Ga0501031_0001813
306 Ga0501032_0001512
307 Ga0501034_0018818
308 Ga0501036_0010730
309 Ga0501037_0000138
310 Ga0501038_0084468
311 Ga0501043_0000062
312 Ga0501046_0000059
313 Ga0501047_0000032
314 Ga0501048_0015216
315 Ga0501069_0024818
316 Ga0501070_0036147
317 Ga0501083_0058577
318 Ga0501035_0001735
319 Ga0501044_0012395
320 nmdc:mga00v17_17000_c2
321 nmdc:mga00v17_4078_c1
322 nmdc:mga0yw44_29557_c1
323 nmdc:mga0yw44_77707_c1
324 nmdc:mga0k408_1745_c1
325 nmdc:mga0k408_29_c1
326 nmdc:mga0k408_46151_c1
327 nmdc:mga0k408_559_c1
328 nmdc:mga06z11_161_c1
329 nmdc:mga04h51_1410_c1
330 Ga0500610_0151846
331 Ga0500644_0002149
332 Ga0500646_0000179
333 Ga0500583_0050747
334 Ga0500651_0000011
335 Ga0500651_0009086
336 Ga0500650_0000001
337 Ga0500562_000002
338 Ga0500562_061956
339 Ga0500594_0000001
340 Ga0500614_009889
341 Ga0500655_005652
342 Ga0500561_0000002
343 Ga0500577_0007692
344 Ga0500579_024698
345 Ga0500633_0006035
346 Ga0501082_0056233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6djy-assembly1.cif.gz_C fako virus 0.4402 138 210
6djy-assembly1.cif.gz_B fako virus 0.407 142 208
6csm-assembly2.cif.gz_C crystal structure of the natural light-gated anion channel gtacr1 0.3634 60 212
6edq-assembly1.cif.gz_A crystal structure of the light-gated anion channelrhodopsin gtacr1 0.3577 60 212
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.3473 10 213
ID Description Score Start End Superfamily
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3867 15 212 1.10.600.10
af_A8DY63_1_264_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3841 30 213 1.20.1250.20
af_Q2FVV0_1_118_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3765 57 168 1.10.1760.20
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3676 19 212 1.10.600.10
af_E7FB98_52_212_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.3675 87 210 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A2M7U0L6-F1-model_v4 Phosphatidate cytidylyltransferase 0.9689 8 212 GO:0004143
GO:0016020
AF-A0A522TX13-F1-model_v4 Phosphatidate cytidylyltransferase 0.9546 6 212 GO:0004143
GO:0016020
AF-A0A7T9KG14-F1-model_v4 deleted 0.9538 8 213
AF-A0A7T9K734-F1-model_v4 deleted 0.9536 5 210
AF-A0A2M7U0L6-F1-model_v4 Phosphatidate cytidylyltransferase 0.9508 8 212 GO:0004143
GO:0016020

Map