F262864

General Info

Members Datasets Scaffolds Average Seq Length
173 117 171 314

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001409|Ga0265338_1000140913
Length 364
Sequence LAGFLLPVVEQNIDHDENLDINISILLVEASFIYENKYLCHAIKYSTMDISVIVPLYNEEESLPELTSWIKNVMTANNFSYEVILINDGSTDLSWNVIKVLSLTDPAIKGIQFQRNYGKSAALQKGFEACSGSVVITMDADLQDSPDEIPELYDMITNQGFDLVSGWKKKRYDPLSKTIPTKLYNGTVRMMTGIKLHDMNCGLKAYKKAVVKSIEVYGEMHRYIPVIASRNGFRKIGEKVVSHQKRKFGITKFGLERFINGPLDLLSILFISKFGKRPMHFFGSMGVLIFMLGFIAAGFLGAEKLYFVFNNVKAKLITQSPYFYLALTCMVMGTQLFLAGFLGELISRNSQDRNTYLVDDKINL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
105 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.58
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 0
Rhizoplane 2.89
Rhizosphere 82.66
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
2 JGI24739J22299_10003595 3300001989 Bacteria 5916
3 JGI24751J29686_10001217 3300002459 Bacteria 5448
4 JGI25162J39368_1004303 3300002737 Bacteria 3395
5 Ga0055526_1004268 3300003771 Bacteria 8657
6 Ga0055528_1001378 3300003790 Bacteria 14923
7 Ga0055530_10002564 3300003791 Bacteria 11538
8 Ga0055531_10000029 3300003794 Bacteria 159248
9 Ga0065165_1000182 3300005262 Bacteria 110108
10 Ga0065704_10070133 3300005289 Bacteria 1266035
11 Ga0070683_100024994 3300005329 Bacteria 5357
12 Ga0070666_10005672 3300005335 Bacteria 7665
13 Ga0070661_100065165 3300005344 Bacteria 2677
14 Ga0070671_100152269 3300005355 Bacteria 1953
15 Ga0070659_100109918 3300005366 Bacteria 2225
16 Ga0070667_100597422 3300005367 Bacteria 1017
17 Ga0070708_100288931 3300005445 Bacteria 1544
18 Ga0070698_100083156 3300005471 Bacteria 3192
19 Ga0070699_100077438 3300005518 Bacteria 2895
20 Ga0068853_100417918 3300005539 Bacteria 1257
21 Ga0068853_100496160 3300005539 Bacteria 1152
22 Ga0070665_100002004 3300005548 Bacteria 22912
23 Ga0068851_10130085 3300005834 Bacteria 1360
24 Ga0070716_100136123 3300006173 Bacteria 1560
25 Ga0070712_100027226 3300006175 Bacteria 3816
26 Ga0075366_10000386 3300006195 Bacteria 20464
27 Ga0075433_10010460 3300006852 Bacteria 7450
28 Ga0075433_10023455 3300006852 Bacteria 5194
29 Ga0075434_100019592 3300006871 Bacteria 6550
30 Ga0075434_100080481 3300006871 Bacteria 3255
31 Ga0075436_100000310 3300006914 Bacteria 31184
32 Ga0075435_100000015 3300007076 Bacteria 100708
33 Ga0105240_10000011 3300009093 Bacteria 523646
34 Ga0105240_10038019 3300009093 Bacteria 6178
35 Ga0105245_10097495 3300009098 Bacteria 2715
36 Ga0114129_10126954 3300009147 Bacteria 3506
37 Ga0114129_10784512 3300009147 Bacteria 1217
38 Ga0105242_10049009 3300009176 Bacteria 3436
39 Ga0105237_10013494 3300009545 Bacteria 8562
40 Ga0105237_10308930 3300009545 Bacteria 1584
41 Ga0105249_10061443 3300009553 Bacteria 3447
42 Ga0105239_10000873 3300010375 Bacteria 42895
43 Ga0105239_10264944 3300010375 Bacteria 1932
44 Ga0157371_10006472 3300013102 Bacteria 9653
45 Ga0157372_10015836 3300013307 Bacteria 8090
46 Ga0157372_10290631 3300013307 Unclassified 1901
47 Ga0157375_10424828 3300013308 Unclassified 1495
48 Ga0157375_10492811 3300013308 Bacteria 1390
49 Ga0163163_10060058 3300014325 Bacteria 3763
50 Ga0163163_10411087 3300014325 Bacteria 1412
51 Ga0157379_10166237 3300014968 Bacteria 1991
52 Ga0207427_100085 3300025231 Bacteria 142561
53 Ga0209437_100052 3300025233 Bacteria 380548
54 Ga0209233_1000067 3300025261 Bacteria 380554
55 Ga0209673_1000016 3300025273 Bacteria 506202
56 Ga0209564_1003905 3300025295 Bacteria 9556
57 Ga0209758_1004456 3300025297 Bacteria 11641
58 Ga0209050_1000124 3300025298 Bacteria 194022
59 Ga0207426_1000520 3300025302 Bacteria 56091
60 Ga0209257_1006203 3300025304 Bacteria 7846
61 Ga0207680_10125518 3300025903 Bacteria 1684
62 Ga0207647_10002070 3300025904 Bacteria 15333
63 Ga0207695_10000010 3300025913 Bacteria 981919
64 Ga0207695_10007871 3300025913 Bacteria 13456
65 Ga0207671_10000248 3300025914 Bacteria 80829
66 Ga0207687_10162483 3300025927 Bacteria 1715
67 Ga0207644_10052008 3300025931 Bacteria 2943
68 Ga0207665_10057220 3300025939 Bacteria 2633
69 Ga0207665_10093036 3300025939 Bacteria 2093
70 Ga0207661_10332637 3300025944 Bacteria 1367
71 Ga0207679_10020306 3300025945 Bacteria 4482
72 Ga0207639_10364011 3300026041 Bacteria 1295
73 Ga0207675_100360838 3300026118 Bacteria 1425
74 Ga0268266_10005189 3300028379 Bacteria 12262
75 Ga0265334_10029267 3300028573 Bacteria 2209
76 Ga0307515_10005287 3300028794 Bacteria 26245
77 Ga0307515_10017194 3300028794 Bacteria 13192
78 Ga0265338_10001409 3300028800 Bacteria 39150
79 Ga0265338_10029841 3300028800 Bacteria 5396
80 Ga0265327_10000006 3300031251 Bacteria 693716
81 Ga0265327_10000046 3300031251 Bacteria 280722
82 Ga0265327_10001552 3300031251 Bacteria 28222
83 Ga0307408_100085055 3300031548 Bacteria 2374
84 Ga0265314_10027449 3300031711 Bacteria 4262
85 Ga0316576_10051951 3300031727 Bacteria 2984
86 Ga0316576_10055387 3300031727 Bacteria 2894
87 Ga0316576_10063692 3300031727 Bacteria 2707
88 Ga0307405_10060948 3300031731 Bacteria 2383
89 Ga0316577_10005285 3300031733 Bacteria 6763
90 Ga0307413_10054623 3300031824 Bacteria 2425
91 Ga0307407_10097681 3300031903 Bacteria 1816
92 Ga0307414_10107663 3300032004 Bacteria 2113
93 Ga0307411_10018968 3300032005 Bacteria 3960
94 Ga0316588_1014626 3300033528 Bacteria 1721
95 Ga0316574_0184513 3300035398 Bacteria 1342
96 Ga0373937_0209353 3300036401 Bacteria 1834
97 Ga0316584_0000475 3300036712 Bacteria 21070
98 Ga0395899_0000006 3300037312 Bacteria 666341
99 Ga0395900_0021365 3300037418 Bacteria 6617
100 Ga0400490_51855 3300038726 Unclassified 1938
101 Ga0400483_029390 3300039062 Bacteria 48364
102 Ga0439431_0010069 3300041997 Bacteria 2141
103 Ga0451577_0000061 3300042876 Bacteria 268366
104 Ga0451577_0000250 3300042876 Bacteria 105934
105 Ga0451577_0036851 3300042876 Bacteria 4403
106 Ga0451577_0058083 3300042876 Bacteria 3449
107 Ga0451577_0070956 3300042876 Bacteria 3106
108 Ga0451577_0088324 3300042876 Bacteria 2766
109 Ga0451577_0194979 3300042876 Bacteria 1828
110 Ga0453683_0000123 3300044673 Bacteria 115551
111 Ga0453683_0011627 3300044673 Bacteria 5798
112 Ga0453683_0090833 3300044673 Bacteria 1914
113 Ga0453683_0169627 3300044673 Bacteria 1382
114 Ga0453683_0242602 3300044673 Bacteria 1148
115 Ga0453684_0000084 3300044712 Bacteria 398306
116 Ga0453684_0000165 3300044712 Bacteria 294572
117 Ga0453684_0001173 3300044712 Bacteria 81352
118 Ga0453684_0002050 3300044712 Bacteria 51274
119 Ga0453684_0002943 3300044712 Bacteria 39941
120 Ga0453684_0004934 3300044712 Bacteria 27202
121 Ga0453684_0006165 3300044712 Bacteria 23060
122 Ga0453684_0006515 3300044712 Bacteria 22126
123 Ga0453684_0015557 3300044712 Bacteria 12014
124 Ga0453684_0021824 3300044712 Bacteria 9536
125 Ga0453684_0037207 3300044712 Bacteria 6683
126 Ga0453684_0045403 3300044712 Bacteria 5862
127 Ga0453684_0094498 3300044712 Bacteria 3678
128 Ga0453684_0197425 3300044712 Bacteria 2348
129 Ga0453684_0295597 3300044712 Bacteria 1842
130 Ga0453684_0347352 3300044712 Bacteria 1674
131 Ga0453684_0378349 3300044712 Bacteria 1590
132 Ga0466970_0110021 3300044765 Bacteria 1504
133 Ga0451576_0000179 3300045051 Bacteria 159850
134 Ga0451576_0002581 3300045051 Bacteria 26653
135 Ga0451576_0007702 3300045051 Bacteria 12806
136 Ga0451576_0012826 3300045051 Bacteria 9403
137 Ga0451576_0029586 3300045051 Bacteria 5861
138 Ga0451576_0030280 3300045051 Bacteria 5785
139 Ga0451576_0589442 3300045051 Bacteria 1168
140 Ga0495587_0177897 3300046536 Bacteria 1207
141 Ga0495636_0000060 3300047318 Bacteria 47278
142 Ga0495686_0000896 3300047472 Bacteria 37508
143 Ga0496109_0002333 3300048912 Bacteria 15815
144 Ga0496111_0019371 3300048914 Bacteria 4725
145 Ga0496114_0000170 3300048917 Bacteria 46131
146 Ga0496114_0322249 3300048917 Bacteria 1366
147 Ga0496115_0005196 3300048918 Bacteria 9465
148 Ga0496121_0000043 3300048924 Bacteria 341882
149 Ga0501033_0067853 3300049570 Bacteria 2623
150 Ga0501067_0047200 3300049583 Bacteria 2389
151 Ga0501067_0086123 3300049583 Unclassified 1743
152 Ga0501068_0013751 3300049584 Bacteria 4611
153 Ga0501069_0002200 3300049585 Bacteria 9817
154 Ga0501199_003547 3300049650 Bacteria 1502
155 Ga0501235_013153 3300049669 Bacteria 1820
156 Ga0501083_0225241 3300049744 Bacteria 1221
157 Ga0501035_0366302 3300049822 Bacteria 1204
158 Ga0501044_0500825 3300049823 Bacteria 1116
159 nmdc:mga05p37_15006_c1 3300050507 Bacteria 9301
160 nmdc:mga0n895_161797_c1 3300050512 Bacteria 2270
161 nmdc:mga0n895_2681_c1 3300050512 Bacteria 14053
162 nmdc:mga0rr50_508_c1 3300050513 Bacteria 20736
163 nmdc:mga08x19_158399_c1 3300050514 Bacteria 1537
164 nmdc:mga08x19_17338_c1 3300050514 Bacteria 4405
165 nmdc:mga08x19_72609_c1 3300050514 Bacteria 2245
166 nmdc:mga0a205_180_c1 3300050515 Bacteria 42950
167 nmdc:mga0a205_256462_c1 3300050515 Bacteria 1627
168 Ga0495595_0161814 3300053084 Bacteria 1105
169 Ga0500559_0114893 3300053136 Bacteria 1249
170 Ga0500616_0016950 3300053153 Bacteria 4137
171 Ga0530510_0027838 3300061734 Bacteria 4050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0177897 Ga0495587_0177897_342_1157 250
2 3300049583 Ga0501067_0086123 Ga0501067_0086123_943_1725 254
3 3300044765 Ga0466970_0110021 Ga0466970_0110021_34_876 275
4 3300049822 Ga0501035_0366302 Ga0501035_0366302_19_921 278
5 3300014968 Ga0157379_10166237 Ga0157379_101662371 281
6 3300002737 JGI25162J39368_1004303 JGI25162J39368_10043035 285
7 3300006195 Ga0075366_10000386 Ga0075366_100003867 285
8 3300025231 Ga0207427_100085 Ga0207427_10008551 285
9 3300025233 Ga0209437_100052 Ga0209437_100052193 285
10 3300025261 Ga0209233_1000067 Ga0209233_1000067193 285
11 3300028794 Ga0307515_10005287 Ga0307515_100052877 285
12 3300028794 Ga0307515_10017194 Ga0307515_100171945 285
13 3300036401 Ga0373937_0209353 Ga0373937_0209353_378_1319 290
14 3300042876 Ga0451577_0088324 Ga0451577_0088324_795_1751 290
15 3300044712 Ga0453684_0000165 Ga0453684_0000165_143562_144518 290
16 3300049744 Ga0501083_0225241 Ga0501083_0225241_168_1106 290
17 3300053084 Ga0495595_0161814 Ga0495595_0161814_96_1040 290
18 3300009098 Ga0105245_10097495 Ga0105245_100974952 291
19 3300025927 Ga0207687_10162483 Ga0207687_101624832 291
20 3300048917 Ga0496114_0322249 Ga0496114_0322249_405_1349 291
21 3300009147 Ga0114129_10784512 Ga0114129_107845122 294
22 3300048924 Ga0496121_0000043 Ga0496121_0000043_244594_245541 294
23 3300050515 nmdc:mga0a205_256462_c1 nmdc:mga0a205_256462_c1_341_1318 294
24 3300031727 Ga0316576_10063692 Ga0316576_100636921 297
25 3300005335 Ga0070666_10005672 Ga0070666_100056726 298
26 3300005367 Ga0070667_100597422 Ga0070667_1005974221 298
27 3300025903 Ga0207680_10125518 Ga0207680_101255182 298
28 3300005539 Ga0068853_100496160 Ga0068853_1004961601 299
29 3300026041 Ga0207639_10364011 Ga0207639_103640111 299
30 3300044673 Ga0453683_0242602 Ga0453683_0242602_16_936 301
31 iso_pu_bacteria 2671180531 2673164370 301
32 3300006852 Ga0075433_10023455 Ga0075433_100234556 302
33 3300047472 Ga0495686_0000896 Ga0495686_0000896_18494_19438 302
34 3300049570 Ga0501033_0067853 Ga0501033_0067853_332_1261 302
35 3300006175 Ga0070712_100027226 Ga0070712_1000272262 304
36 3300044712 Ga0453684_0197425 Ga0453684_0197425_958_1953 304
37 3300006871 Ga0075434_100080481 Ga0075434_1000804812 306
38 3300031727 Ga0316576_10051951 Ga0316576_100519512 306
39 3300031727 Ga0316576_10055387 Ga0316576_100553873 306
40 3300035398 Ga0316574_0184513 Ga0316574_0184513_141_1094 306
41 3300044712 Ga0453684_0045403 Ga0453684_0045403_2699_3649 306
42 3300045051 Ga0451576_0007702 Ga0451576_0007702_7037_7987 306
43 3300049583 Ga0501067_0047200 Ga0501067_0047200_300_1238 306
44 3300049584 Ga0501068_0013751 Ga0501068_0013751_3460_4398 306
45 3300049585 Ga0501069_0002200 Ga0501069_0002200_1238_2176 306
46 3300050512 nmdc:mga0n895_161797_c1 nmdc:mga0n895_161797_c1_34_972 306
47 3300050514 nmdc:mga08x19_158399_c1 nmdc:mga08x19_158399_c1_355_1293 306
48 3300061734 Ga0530510_0027838 Ga0530510_0027838_1624_2562 306
49 3300005445 Ga0070708_100288931 Ga0070708_1002889312 308
50 3300005471 Ga0070698_100083156 Ga0070698_1000831563 308
51 3300005518 Ga0070699_100077438 Ga0070699_1000774383 308
52 3300006852 Ga0075433_10010460 Ga0075433_100104606 308
53 3300006871 Ga0075434_100019592 Ga0075434_1000195923 308
54 3300006914 Ga0075436_100000310 Ga0075436_1000003106 308
55 3300007076 Ga0075435_100000015 Ga0075435_10000001586 308
56 3300025939 Ga0207665_10057220 Ga0207665_100572202 308
57 3300050512 nmdc:mga0n895_2681_c1 nmdc:mga0n895_2681_c1_4988_5932 308
58 3300050513 nmdc:mga0rr50_508_c1 nmdc:mga0rr50_508_c1_11450_12394 308
59 3300050514 nmdc:mga08x19_17338_c1 nmdc:mga08x19_17338_c1_1104_2048 308
60 3300050514 nmdc:mga08x19_72609_c1 nmdc:mga08x19_72609_c1_511_1488 308
61 3300050515 nmdc:mga0a205_180_c1 nmdc:mga0a205_180_c1_32899_33876 308
62 3300053153 Ga0500616_0016950 Ga0500616_0016950_1921_2856 308
63 3300031711 Ga0265314_10027449 Ga0265314_100274497 310
64 iso_pu_bacteria 2818991444 2819588301 310
65 3300031251 Ga0265327_10001552 Ga0265327_1000155218 311
66 3300038726 Ga0400490_51855 Ga0400490_51855_443_1390 311
67 3300042876 Ga0451577_0000250 Ga0451577_0000250_41030_41980 311
68 3300048912 Ga0496109_0002333 Ga0496109_0002333_5797_6882 311
69 3300048914 Ga0496111_0019371 Ga0496111_0019371_2919_4004 311
70 3300049823 Ga0501044_0500825 Ga0501044_0500825_42_1016 311
71 3300009147 Ga0114129_10126954 Ga0114129_101269543 312
72 3300014325 Ga0163163_10411087 Ga0163163_104110872 312
73 3300026118 Ga0207675_100360838 Ga0207675_1003608382 312
74 3300031733 Ga0316577_10005285 Ga0316577_100052858 312
75 3300036712 Ga0316584_0000475 Ga0316584_0000475_14824_15774 312
76 3300042876 Ga0451577_0194979 Ga0451577_0194979_52_990 312
77 3300044712 Ga0453684_0002943 Ga0453684_0002943_34836_35786 312
78 3300044712 Ga0453684_0006165 Ga0453684_0006165_1551_2501 312
79 3300044712 Ga0453684_0037207 Ga0453684_0037207_1767_2705 312
80 3300050507 nmdc:mga05p37_15006_c1 nmdc:mga05p37_15006_c1_4002_5015 312
81 3300003794 Ga0055531_10000029 Ga0055531_1000002942 313
82 3300005539 Ga0068853_100417918 Ga0068853_1004179181 313
83 3300006173 Ga0070716_100136123 Ga0070716_1001361232 313
84 3300013308 Ga0157375_10424828 Ga0157375_104248282 313
85 3300013308 Ga0157375_10492811 Ga0157375_104928111 313
86 3300025939 Ga0207665_10093036 Ga0207665_100930362 313
87 3300028573 Ga0265334_10029267 Ga0265334_100292671 313
88 3300031251 Ga0265327_10000006 Ga0265327_10000006219 313
89 3300032004 Ga0307414_10107663 Ga0307414_101076632 313
90 3300033528 Ga0316588_1014626 Ga0316588_10146262 313
91 3300037312 Ga0395899_0000006 Ga0395899_0000006_23711_24664 313
92 3300037418 Ga0395900_0021365 Ga0395900_0021365_2406_3359 313
93 3300042876 Ga0451577_0000061 Ga0451577_0000061_42622_43578 313
94 3300042876 Ga0451577_0036851 Ga0451577_0036851_2251_3204 313
95 3300042876 Ga0451577_0058083 Ga0451577_0058083_2185_3141 313
96 3300044673 Ga0453683_0000123 Ga0453683_0000123_69658_70611 313
97 3300044673 Ga0453683_0011627 Ga0453683_0011627_4148_5104 313
98 3300044673 Ga0453683_0169627 Ga0453683_0169627_265_1218 313
99 3300044712 Ga0453684_0000084 Ga0453684_0000084_178560_179516 313
100 3300044712 Ga0453684_0001173 Ga0453684_0001173_29959_30915 313
101 3300044712 Ga0453684_0002050 Ga0453684_0002050_18887_19840 313
102 3300044712 Ga0453684_0295597 Ga0453684_0295597_831_1787 313
103 3300044712 Ga0453684_0347352 Ga0453684_0347352_261_1217 313
104 3300044712 Ga0453684_0378349 Ga0453684_0378349_550_1503 313
105 3300045051 Ga0451576_0000179 Ga0451576_0000179_1304_2260 313
106 3300045051 Ga0451576_0029586 Ga0451576_0029586_1204_2160 313
107 3300045051 Ga0451576_0030280 Ga0451576_0030280_1563_2516 313
108 3300045051 Ga0451576_0589442 Ga0451576_0589442_82_1038 313
109 3300002459 JGI24751J29686_10001217 JGI24751J29686_100012176 314
110 3300005329 Ga0070683_100024994 Ga0070683_1000249945 314
111 3300005344 Ga0070661_100065165 Ga0070661_1000651652 314
112 3300005355 Ga0070671_100152269 Ga0070671_1001522692 314
113 3300005366 Ga0070659_100109918 Ga0070659_1001099183 314
114 3300005834 Ga0068851_10130085 Ga0068851_101300852 314
115 3300009553 Ga0105249_10061443 Ga0105249_100614432 314
116 3300013102 Ga0157371_10006472 Ga0157371_100064725 314
117 3300013307 Ga0157372_10015836 Ga0157372_100158363 314
118 3300013307 Ga0157372_10290631 Ga0157372_102906312 314
119 3300014325 Ga0163163_10060058 Ga0163163_100600583 314
120 3300025931 Ga0207644_10052008 Ga0207644_100520082 314
121 3300025944 Ga0207661_10332637 Ga0207661_103326372 314
122 3300025945 Ga0207679_10020306 Ga0207679_100203063 314
123 3300031548 Ga0307408_100085055 Ga0307408_1000850552 314
124 3300031731 Ga0307405_10060948 Ga0307405_100609482 314
125 3300031824 Ga0307413_10054623 Ga0307413_100546232 314
126 3300031903 Ga0307407_10097681 Ga0307407_100976812 314
127 3300039062 Ga0400483_029390 Ga0400483_029390_46140_47102 314
128 3300042876 Ga0451577_0070956 Ga0451577_0070956_432_1388 314
129 3300044673 Ga0453683_0090833 Ga0453683_0090833_699_1655 314
130 3300044712 Ga0453684_0004934 Ga0453684_0004934_1648_2616 314
131 3300044712 Ga0453684_0006515 Ga0453684_0006515_18841_19797 314
132 3300044712 Ga0453684_0021824 Ga0453684_0021824_1132_2100 314
133 3300044712 Ga0453684_0094498 Ga0453684_0094498_1134_2090 314
134 3300045051 Ga0451576_0012826 Ga0451576_0012826_7204_8172 314
135 3300048918 Ga0496115_0005196 Ga0496115_0005196_7876_8841 314
136 3300049650 Ga0501199_003547 Ga0501199_003547_403_1347 314
137 3300049669 Ga0501235_013153 Ga0501235_013153_721_1665 314
138 3300001989 JGI24739J22299_10003595 JGI24739J22299_100035956 315
139 3300003771 Ga0055526_1004268 Ga0055526_10042681 315
140 3300003790 Ga0055528_1001378 Ga0055528_100137812 315
141 3300003791 Ga0055530_10002564 Ga0055530_100025643 315
142 3300005262 Ga0065165_1000182 Ga0065165_100018290 315
143 3300005548 Ga0070665_100002004 Ga0070665_1000020045 315
144 3300009093 Ga0105240_10000011 Ga0105240_10000011416 315
145 3300009093 Ga0105240_10038019 Ga0105240_100380192 315
146 3300009176 Ga0105242_10049009 Ga0105242_100490093 315
147 3300009545 Ga0105237_10013494 Ga0105237_100134946 315
148 3300009545 Ga0105237_10308930 Ga0105237_103089302 315
149 3300010375 Ga0105239_10000873 Ga0105239_1000087332 315
150 3300010375 Ga0105239_10264944 Ga0105239_102649443 315
151 3300025273 Ga0209673_1000016 Ga0209673_100001660 315
152 3300025295 Ga0209564_1003905 Ga0209564_10039059 315
153 3300025297 Ga0209758_1004456 Ga0209758_10044569 315
154 3300025298 Ga0209050_1000124 Ga0209050_1000124119 315
155 3300025302 Ga0207426_1000520 Ga0207426_100052010 315
156 3300025304 Ga0209257_1006203 Ga0209257_10062032 315
157 3300025904 Ga0207647_10002070 Ga0207647_100020703 315
158 3300025913 Ga0207695_10007871 Ga0207695_100078716 315
159 3300025914 Ga0207671_10000248 Ga0207671_1000024842 315
160 3300028379 Ga0268266_10005189 Ga0268266_100051892 315
161 3300028800 Ga0265338_10001409 Ga0265338_1000140913 315
162 3300032005 Ga0307411_10018968 Ga0307411_100189681 315
163 3300041997 Ga0439431_0010069 Ga0439431_0010069_467_1426 315
164 3300044712 Ga0453684_0015557 Ga0453684_0015557_793_1866 315
165 3300045051 Ga0451576_0002581 Ga0451576_0002581_13192_14163 315
166 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00002450 316
167 3300005289 Ga0065704_10070133 Ga0065704_10070133243 316
168 3300025913 Ga0207695_10000010 Ga0207695_10000010806 316
169 3300028800 Ga0265338_10029841 Ga0265338_100298414 316
170 3300031251 Ga0265327_10000046 Ga0265327_10000046159 316
171 3300047318 Ga0495636_0000060 Ga0495636_0000060_10989_11939 316
172 3300048917 Ga0496114_0000170 Ga0496114_0000170_6137_7087 316
173 3300053136 Ga0500559_0114893 Ga0500559_0114893_169_1137 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

51

215

0.95

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

51

162

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7522 1 316
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7505 3 228
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7482 1 316
5jsx-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+ and uridine-diphosphate-glucose (udp-glc) 0.7467 3 228
5ekp-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7444 1 316
ID Description Score Start End Superfamily
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8878 3 224 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8699 3 184 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8621 3 231 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8595 3 231 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8584 3 224 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V6H0B7-F1-model_v4 Glycosyltransferase 1.002 3 85 GO:0005886
GO:0099621
AF-A0A3D2J9K3-F1-model_v4 Glycosyltransferase 0.9824 1 105 GO:0005886
GO:0016757
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9821 2 105 GO:0005886
GO:0099621
AF-A0A3D3EY49-F1-model_v4 Glycosyltransferase 0.9682 5 188 GO:0005886
GO:0099621
AF-A0A7Y2G2C6-F1-model_v4 Glycosyltransferase family 2 protein 0.9679 3 221 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
86.25 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map