F263232

General Info

Members Datasets Scaffolds Average Seq Length
173 132 346 257

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0003643|Ga0495642_0003643_3952_4794
Length 280
Sequence MHQRQLMYMQDMTTQQLRPDVAPPEFLQLAGHPLRWRLLSELARSDRLVHELTGLVGEAQNLVSYHLGKLRDGRLVSARRSSADRRDTYYGLDLARVGRLLSAAGGALHPGLRLTAPSRAAAPTAPVRVLFLCSGNSARSPMAEALARARSGGAIEAYSAGSHPKLVHPNAVRVMRDEYGLDLTGHESRRLDVFAGQRFDWVISLCDRVREVCPEFPGHPEVIHWSIANPATGETDDVTYPLFQQTAAELATRVDFLLAALSDQTPAPGSAQEAQDGEVP

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 2643221615 Nocardioides sp. Root224 Isolate Unclassified
131 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
132 2687453737 Frankia sp. BMG5.36 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0.58
Rhizoplane 5.2
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0003643 3300046528 Bacteria 6050
2 Ga0070683_100143172 3300005329 Bacteria 2265
3 Ga0070670_100010452 3300005331 Bacteria 7921
4 Ga0070670_100210698 3300005331 Bacteria 1690
5 Ga0070668_100003407 3300005347 Bacteria 11738
6 Ga0070671_100125908 3300005355 Bacteria 2157
7 Ga0070673_100140608 3300005364 Bacteria 2036
8 Ga0070659_100183954 3300005366 Bacteria 1715
9 Ga0070667_100006285 3300005367 Bacteria 9873
10 Ga0070708_100685779 3300005445 Bacteria 965
11 Ga0070678_100304343 3300005456 Bacteria 1356
12 Ga0070681_10018926 3300005458 Bacteria 6891
13 Ga0070681_10118844 3300005458 Bacteria 2579
14 Ga0070707_100271537 3300005468 Bacteria 1649
15 Ga0070679_100020575 3300005530 Bacteria 6435
16 Ga0070679_100670831 3300005530 Unclassified 979
17 Ga0070684_100288304 3300005535 Bacteria 1505
18 Ga0068853_100119242 3300005539 Bacteria 2351
19 Ga0070665_100000921 3300005548 Bacteria 37702
20 Ga0068855_100033296 3300005563 Bacteria 6152
21 Ga0068855_100049673 3300005563 Bacteria 4946
22 Ga0068855_100151240 3300005563 Bacteria 2639
23 Ga0068855_100522963 3300005563 Bacteria 1287
24 Ga0070664_100099451 3300005564 Bacteria 2528
25 Ga0068857_100123033 3300005577 Bacteria 2337
26 Ga0068852_100487758 3300005616 Bacteria 1225
27 Ga0068859_100192226 3300005617 Bacteria 2125
28 Ga0068864_100062768 3300005618 Bacteria 3219
29 Ga0068864_100175693 3300005618 Bacteria 1955
30 Ga0068861_100077643 3300005719 Bacteria 2591
31 Ga0068863_100305864 3300005841 Bacteria 1543
32 Ga0068860_100000051 3300005843 Bacteria 208179
33 Ga0068860_100040473 3300005843 Bacteria 4453
34 Ga0068862_100009989 3300005844 Bacteria 7842
35 Ga0068862_100016156 3300005844 Bacteria 6209
36 Ga0068862_100885981 3300005844 Unclassified 876
37 Ga0081455_10127861 3300005937 Bacteria 1991
38 Ga0081538_10000691 3300005981 Bacteria 37035
39 Ga0081538_10001965 3300005981 Bacteria 20589
40 Ga0081538_10063331 3300005981 Bacteria 2100
41 Ga0070712_100019455 3300006175 Bacteria 4429
42 Ga0068865_100000361 3300006881 Bacteria 25141
43 Ga0097620_100192207 3300006931 Bacteria 2125
44 Ga0105240_10016966 3300009093 Bacteria 9838
45 Ga0105240_10228049 3300009093 Bacteria 2166
46 Ga0105240_10615166 3300009093 Bacteria 1195
47 Ga0105248_10000782 3300009177 Bacteria 35721
48 Ga0105248_10127550 3300009177 Bacteria 2870
49 Ga0105237_10189792 3300009545 Bacteria 2055
50 Ga0105238_10026932 3300009551 Bacteria 5860
51 Ga0105238_10045424 3300009551 Bacteria 4437
52 Ga0105238_10048588 3300009551 Bacteria 4275
53 Ga0105238_10243504 3300009551 Bacteria 1776
54 Ga0105249_10054706 3300009553 Bacteria 3650
55 Ga0105239_10160078 3300010375 Bacteria 2515
56 Ga0105239_10377353 3300010375 Bacteria 1603
57 Ga0105239_10395162 3300010375 Bacteria 1564
58 Ga0157369_10005395 3300013105 Bacteria 14884
59 Ga0157369_10462363 3300013105 Bacteria 1314
60 Ga0157372_10716167 3300013307 Bacteria 1164
61 Ga0157375_10026412 3300013308 Bacteria 5411
62 Ga0163163_10143770 3300014325 Bacteria 2428
63 Ga0163163_10840327 3300014325 Bacteria 982
64 Ga0209026_1003744 3300025250 Bacteria 4827
65 Ga0207699_10049765 3300025906 Bacteria 2468
66 Ga0207705_10068130 3300025909 Bacteria 2576
67 Ga0207705_10260272 3300025909 Bacteria 1325
68 Ga0207707_10142636 3300025912 Bacteria 2094
69 Ga0207707_10276024 3300025912 Bacteria 1456
70 Ga0207695_10027506 3300025913 Bacteria 6331
71 Ga0207693_10161386 3300025915 Bacteria 1763
72 Ga0207660_10011632 3300025917 Bacteria 5738
73 Ga0207657_10013587 3300025919 Bacteria 7985
74 Ga0207657_10052367 3300025919 Bacteria 3542
75 Ga0207652_10249019 3300025921 Bacteria 1602
76 Ga0207646_10253459 3300025922 Bacteria 1590
77 Ga0207694_10024776 3300025924 Bacteria 4558
78 Ga0207694_10045411 3300025924 Bacteria 3394
79 Ga0207694_10338276 3300025924 Bacteria 1244
80 Ga0207690_10325860 3300025932 Unclassified 1208
81 Ga0207706_10030213 3300025933 Bacteria 4835
82 Ga0207704_10007298 3300025938 Bacteria 5214
83 Ga0207711_10000302 3300025941 Bacteria 52984
84 Ga0207711_10645799 3300025941 Bacteria 987
85 Ga0207661_10605396 3300025944 Bacteria 1006
86 Ga0207667_10060483 3300025949 Bacteria 3964
87 Ga0207667_10070219 3300025949 Bacteria 3646
88 Ga0207667_10164360 3300025949 Bacteria 2282
89 Ga0207667_10417592 3300025949 Bacteria 1365
90 Ga0207668_10011417 3300025972 Bacteria 5396
91 Ga0207668_10072202 3300025972 Bacteria 2468
92 Ga0207658_10296440 3300025986 Bacteria 1391
93 Ga0207639_10159947 3300026041 Bacteria 1897
94 Ga0207639_10188171 3300026041 Bacteria 1761
95 Ga0207641_10110146 3300026088 Bacteria 2440
96 Ga0207676_10209743 3300026095 Bacteria 1727
97 Ga0207676_10339475 3300026095 Bacteria 1385
98 Ga0207675_100046422 3300026118 Bacteria 4058
99 Ga0268266_10000003 3300028379 Bacteria 1701703
100 Ga0268265_10017175 3300028380 Bacteria 4987
101 Ga0268265_10098768 3300028380 Bacteria 2352
102 Ga0268264_10000021 3300028381 Bacteria 481580
103 Ga0268264_10280114 3300028381 Bacteria 1561
104 Ga0307511_10059333 3300030521 Bacteria 2944
105 Ga0265325_10004200 3300031241 Bacteria 9150
106 Ga0265339_10014044 3300031249 Bacteria 4837
107 Ga0265327_10000275 3300031251 Bacteria 101668
108 Ga0265316_10015415 3300031344 Bacteria 6684
109 Ga0265342_10099577 3300031712 Bacteria 1658
110 Ga0307516_10000001 3300031730 Bacteria 510338
111 Ga0307405_10492112 3300031731 Bacteria 981
112 Ga0307413_10315981 3300031824 Bacteria 1191
113 Ga0307406_10082497 3300031901 Bacteria 2141
114 Ga0307406_10084754 3300031901 Bacteria 2117
115 Ga0307416_100120549 3300032002 Bacteria 2336
116 Ga0307415_100685984 3300032126 Bacteria 922
117 Ga0373936_0009520 3300035113 Bacteria 3662
118 Ga0373933_0221488 3300035724 Bacteria 1214
119 Ga0373937_0239102 3300036401 Bacteria 1711
120 Ga0395899_0000083 3300037312 Bacteria 161878
121 Ga0395900_0000004 3300037418 Bacteria 564908
122 Ga0395898_0019481 3300037466 Bacteria 6904
123 Ga0395905_0175890 3300037471 Bacteria 2010
124 Ga0395905_0295168 3300037471 Bacteria 1508
125 Ga0395901_0000005 3300038443 Bacteria 544998
126 Ga0436365_1106406 3300039437 Bacteria 17151
127 Ga0451791_1873520 3300041451 Bacteria 2311
128 Ga0451837_1839495 3300041494 Bacteria 1072
129 Ga0495592_0215112 3300046454 Bacteria 1288
130 Ga0495639_0200661 3300046475 Bacteria 976
131 Ga0495664_0114967 3300046477 Bacteria 1626
132 Ga0495628_0232784 3300046516 Bacteria 1380
133 Ga0495586_0158476 3300046535 Bacteria 1276
134 Ga0495645_0023142 3300046543 Bacteria 4498
135 Ga0495668_0050623 3300046616 Bacteria 2302
136 Ga0495668_0051733 3300046616 Bacteria 2274
137 Ga0495634_0215403 3300046642 Bacteria 1187
138 Ga0495599_0148817 3300046678 Bacteria 1451
139 Ga0495613_0185832 3300046689 Bacteria 1470
140 Ga0495670_0136929 3300046691 Bacteria 1279
141 Ga0495636_0086524 3300047318 Bacteria 1356
142 Ga0495684_0230167 3300047471 Bacteria 1356
143 Ga0496101_0456392 3300048904 Bacteria 1008
144 Ga0496102_0119668 3300048905 Bacteria 2459
145 Ga0496108_0145568 3300048911 Bacteria 2043
146 Ga0496108_0172947 3300048911 Bacteria 1869
147 Ga0496109_0501868 3300048912 Bacteria 1145
148 Ga0496112_0130959 3300048915 Bacteria 2479
149 Ga0496113_0357662 3300048916 Bacteria 1171
150 Ga0496115_0022278 3300048918 Bacteria 4907
151 Ga0496116_0006556 3300048919 Bacteria 10540
152 Ga0496118_0005532 3300048921 Bacteria 14336
153 Ga0496119_0000763 3300048922 Bacteria 43180
154 Ga0501032_0199614 3300049569 Bacteria 1305
155 Ga0501033_0065870 3300049570 Bacteria 2664
156 Ga0501036_0005580 3300049572 Bacteria 10204
157 Ga0501038_0002656 3300049574 Bacteria 16704
158 Ga0501043_0061240 3300049579 Bacteria 2955
159 Ga0501046_0171387 3300049580 Bacteria 1628
160 Ga0501067_0192374 3300049583 Bacteria 1136
161 Ga0501069_0140677 3300049585 Bacteria 1384
162 Ga0501073_0013838 3300049589 Bacteria 5866
163 Ga0501074_0010439 3300049590 Bacteria 6740
164 Ga0501035_0028642 3300049822 Bacteria 5084
165 Ga0495595_0040631 3300053084 Bacteria 2126
166 Ga0495619_0033796 3300053085 Bacteria 3322
167 Ga0495619_0203692 3300053085 Bacteria 1370
168 Ga0500556_0000567 3300053104 Bacteria 24565
169 Ga0500593_000133 3300053117 Bacteria 29664
170 Ga0501082_0027248 3300060353 Bacteria 4920
171 2644091944 2643221615 Bacteria 5487866
172 2644321747 2643221657 Bacteria 5490246
173 2689957204 2687453737 Bacteria 11203906
174 Ga0495642_0003643
175 Ga0070683_100143172
176 Ga0070670_100010452
177 Ga0070670_100210698
178 Ga0070668_100003407
179 Ga0070671_100125908
180 Ga0070673_100140608
181 Ga0070659_100183954
182 Ga0070667_100006285
183 Ga0070708_100685779
184 Ga0070678_100304343
185 Ga0070681_10018926
186 Ga0070681_10118844
187 Ga0070707_100271537
188 Ga0070679_100020575
189 Ga0070679_100670831
190 Ga0070684_100288304
191 Ga0068853_100119242
192 Ga0070665_100000921
193 Ga0068855_100033296
194 Ga0068855_100049673
195 Ga0068855_100151240
196 Ga0068855_100522963
197 Ga0070664_100099451
198 Ga0068857_100123033
199 Ga0068852_100487758
200 Ga0068859_100192226
201 Ga0068864_100062768
202 Ga0068864_100175693
203 Ga0068861_100077643
204 Ga0068863_100305864
205 Ga0068860_100000051
206 Ga0068860_100040473
207 Ga0068862_100009989
208 Ga0068862_100016156
209 Ga0068862_100885981
210 Ga0081455_10127861
211 Ga0081538_10000691
212 Ga0081538_10001965
213 Ga0081538_10063331
214 Ga0070712_100019455
215 Ga0068865_100000361
216 Ga0097620_100192207
217 Ga0105240_10016966
218 Ga0105240_10228049
219 Ga0105240_10615166
220 Ga0105248_10000782
221 Ga0105248_10127550
222 Ga0105237_10189792
223 Ga0105238_10026932
224 Ga0105238_10045424
225 Ga0105238_10048588
226 Ga0105238_10243504
227 Ga0105249_10054706
228 Ga0105239_10160078
229 Ga0105239_10377353
230 Ga0105239_10395162
231 Ga0157369_10005395
232 Ga0157369_10462363
233 Ga0157372_10716167
234 Ga0157375_10026412
235 Ga0163163_10143770
236 Ga0163163_10840327
237 Ga0209026_1003744
238 Ga0207699_10049765
239 Ga0207705_10068130
240 Ga0207705_10260272
241 Ga0207707_10142636
242 Ga0207707_10276024
243 Ga0207695_10027506
244 Ga0207693_10161386
245 Ga0207660_10011632
246 Ga0207657_10013587
247 Ga0207657_10052367
248 Ga0207652_10249019
249 Ga0207646_10253459
250 Ga0207694_10024776
251 Ga0207694_10045411
252 Ga0207694_10338276
253 Ga0207690_10325860
254 Ga0207706_10030213
255 Ga0207704_10007298
256 Ga0207711_10000302
257 Ga0207711_10645799
258 Ga0207661_10605396
259 Ga0207667_10060483
260 Ga0207667_10070219
261 Ga0207667_10164360
262 Ga0207667_10417592
263 Ga0207668_10011417
264 Ga0207668_10072202
265 Ga0207658_10296440
266 Ga0207639_10159947
267 Ga0207639_10188171
268 Ga0207641_10110146
269 Ga0207676_10209743
270 Ga0207676_10339475
271 Ga0207675_100046422
272 Ga0268266_10000003
273 Ga0268265_10017175
274 Ga0268265_10098768
275 Ga0268264_10000021
276 Ga0268264_10280114
277 Ga0307511_10059333
278 Ga0265325_10004200
279 Ga0265339_10014044
280 Ga0265327_10000275
281 Ga0265316_10015415
282 Ga0265342_10099577
283 Ga0307516_10000001
284 Ga0307405_10492112
285 Ga0307413_10315981
286 Ga0307406_10082497
287 Ga0307406_10084754
288 Ga0307416_100120549
289 Ga0307415_100685984
290 Ga0373936_0009520
291 Ga0373933_0221488
292 Ga0373937_0239102
293 Ga0395899_0000083
294 Ga0395900_0000004
295 Ga0395898_0019481
296 Ga0395905_0175890
297 Ga0395905_0295168
298 Ga0395901_0000005
299 Ga0436365_1106406
300 Ga0451791_1873520
301 Ga0451837_1839495
302 Ga0495592_0215112
303 Ga0495639_0200661
304 Ga0495664_0114967
305 Ga0495628_0232784
306 Ga0495586_0158476
307 Ga0495645_0023142
308 Ga0495668_0050623
309 Ga0495668_0051733
310 Ga0495634_0215403
311 Ga0495599_0148817
312 Ga0495613_0185832
313 Ga0495670_0136929
314 Ga0495636_0086524
315 Ga0495684_0230167
316 Ga0496101_0456392
317 Ga0496102_0119668
318 Ga0496108_0145568
319 Ga0496108_0172947
320 Ga0496109_0501868
321 Ga0496112_0130959
322 Ga0496113_0357662
323 Ga0496115_0022278
324 Ga0496116_0006556
325 Ga0496118_0005532
326 Ga0496119_0000763
327 Ga0501032_0199614
328 Ga0501033_0065870
329 Ga0501036_0005580
330 Ga0501038_0002656
331 Ga0501043_0061240
332 Ga0501046_0171387
333 Ga0501067_0192374
334 Ga0501069_0140677
335 Ga0501073_0013838
336 Ga0501074_0010439
337 Ga0501035_0028642
338 Ga0495595_0040631
339 Ga0495619_0033796
340 Ga0495619_0203692
341 Ga0500556_0000567
342 Ga0500593_000133
343 Ga0501082_0027248
344 2644091944
345 2644321747
346 2689957204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

32

78

0.96

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

129

258

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9483 112 245
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.939 112 246
6o8o-assembly2.cif.gz_D crystal structure of c9s disulfide state of sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulatus. 0.938 14 85
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.928 111 243
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9274 112 245
ID Description Score Start End Superfamily
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 35 79 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 20 79 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9545 20 85 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9311 16 80 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 26 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9VFI2-F1-model_v4 ArsR family transcriptional regulator 0.9682 10 250 GO:0003700
GO:0046685
AF-A0A2G9YLL4-F1-model_v4 Protein-tyrosine-phosphatase 0.963 112 246 GO:0046685
AF-A0A524LTQ5-F1-model_v4 Arsenate reductase ArsC 0.961 113 240 GO:0046685
AF-E1IAS5-F1-model_v4 Protein tyrosine phosphatase 0.9603 15 250 GO:0003700
GO:0046685
AF-A0A2S8FER2-F1-model_v4 Low molecular weight phosphatase family protein 0.96 113 245 GO:0046685

Map