F263444

General Info

Members Datasets Scaffolds Average Seq Length
173 123 346 229

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_98_c1|nmdc:mga0yw44_98_c1_17612_18301
Length 209
Sequence MSDVIPQHIGYIVDGNRRWAKSHGLPTYEGHLAGYNAILDVVLATVDAGVKYVSAYTFSTENWKRSEDEVSRLMGLTLKMLTADIGILQKNNIRLQVLGSRERLSTLAVCFNYGGHQEIADACRKIVQAGTPAEEITPDLIAAHLYAPDVPPIDVIVRTSGEQRLSNFMLWRASYSEFLSLEKMWPDMTKDDVTAILEEYSRRGRRFGG

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
69 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
70 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
71 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
87 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
91 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
116 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
123 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.81
Nodule 0
Rhizoplane 1.16
Rhizosphere 75.14
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_98_c1 3300050492 Bacteria 30535
2 MBSR1b_contig_12636410 2162886012 Bacteria 7606
3 MBSR1b_contig_5220965 2162886012 Bacteria 5769
4 JGI24740J21852_10001357 3300001979 Bacteria 11170
5 JGI24737J22298_10000814 3300001990 Bacteria 11066
6 JGI24743J22301_10010548 3300001991 Bacteria 1651
7 JGI24735J21928_10000107 3300002067 Bacteria 30612
8 rootH1_10023981 3300003316 Bacteria 29521
9 rootH2_10000659 3300003320 Bacteria 146718
10 rootH2_10302552 3300003320 Bacteria 1721
11 rootH1_10058345 3300003323 Bacteria 42716
12 JGI25405J52794_10007187 3300003911 Bacteria 2049
13 Ga0065715_10089232 3300005293 Bacteria 12126
14 Ga0070683_100001508 3300005329 Bacteria 17978
15 Ga0070670_100373573 3300005331 Bacteria 1255
16 Ga0070660_100000099 3300005339 Bacteria 52371
17 Ga0070660_100030588 3300005339 Bacteria 4039
18 Ga0070692_10017754 3300005345 Bacteria 3409
19 Ga0070675_100431069 3300005354 Bacteria 1180
20 Ga0070659_100015390 3300005366 Bacteria 5729
21 Ga0070662_100005004 3300005457 Bacteria 8429
22 Ga0070681_10112419 3300005458 Bacteria 2663
23 Ga0068855_100000138 3300005563 Bacteria 92676
24 Ga0068855_100000364 3300005563 Bacteria 56128
25 Ga0068855_100001636 3300005563 Bacteria 28089
26 Ga0070664_100001935 3300005564 Bacteria 16648
27 Ga0068857_100000117 3300005577 Bacteria 47726
28 Ga0068854_100058515 3300005578 Unclassified 2782
29 Ga0068856_100000354 3300005614 Bacteria 50023
30 Ga0068852_100768597 3300005616 Bacteria 976
31 Ga0068863_100446199 3300005841 Bacteria 1269
32 Ga0081455_10000006 3300005937 Bacteria 323066
33 Ga0075365_10000091 3300006038 Bacteria 26191
34 Ga0075364_10000244 3300006051 Bacteria 26177
35 Ga0075367_10000110 3300006178 Bacteria 23417
36 Ga0075366_10000943 3300006195 Bacteria 14152
37 Ga0075370_10002351 3300006353 Bacteria 8747
38 Ga0075370_10039406 3300006353 Bacteria 2662
39 Ga0075370_10058625 3300006353 Bacteria 2190
40 Ga0075428_100061007 3300006844 Bacteria 4129
41 Ga0068865_100001723 3300006881 Bacteria 12834
42 Ga0105240_10000004 3300009093 Bacteria 708156
43 Ga0105240_10005031 3300009093 Bacteria 19837
44 Ga0105240_10009236 3300009093 Bacteria 13988
45 Ga0105245_10909075 3300009098 Bacteria 922
46 Ga0105241_10674547 3300009174 Bacteria 941
47 Ga0105237_10000001 3300009545 Bacteria 1009213
48 Ga0105032_100003 3300009979 Bacteria 186985
49 Ga0105032_100022 3300009979 Bacteria 40670
50 Ga0105239_10001619 3300010375 Bacteria 29743
51 Ga0105239_10138957 3300010375 Bacteria 2706
52 Ga0105246_10002269 3300011119 Bacteria 11601
53 Ga0157373_10103659 3300013100 Bacteria 2001
54 Ga0157371_10024164 3300013102 Bacteria 4439
55 Ga0157371_10091224 3300013102 Unclassified 2158
56 Ga0157371_10528496 3300013102 Bacteria 873
57 Ga0157370_10000706 3300013104 Bacteria 41789
58 Ga0157370_10001253 3300013104 Bacteria 31691
59 Ga0157370_10142153 3300013104 Unclassified 2236
60 Ga0157369_10000024 3300013105 Bacteria 225851
61 Ga0157369_10000444 3300013105 Bacteria 54827
62 Ga0157369_10002588 3300013105 Bacteria 21632
63 Ga0157374_10000501 3300013296 Bacteria 35418
64 Ga0157372_10000002 3300013307 Bacteria 687862
65 Ga0157372_10000008 3300013307 Bacteria 305449
66 Ga0157372_10020496 3300013307 Bacteria 7135
67 Ga0157377_10005025 3300014745 Bacteria 6174
68 Ga0207647_10000315 3300025904 Bacteria 40274
69 Ga0207707_10277804 3300025912 Unclassified 1451
70 Ga0207695_10000009 3300025913 Bacteria 1034276
71 Ga0207695_10008875 3300025913 Bacteria 12517
72 Ga0207695_10040778 3300025913 Bacteria 4973
73 Ga0207671_10000003 3300025914 Bacteria 1065461
74 Ga0207657_10001204 3300025919 Bacteria 27540
75 Ga0207657_10068646 3300025919 Bacteria 3011
76 Ga0207649_10223083 3300025920 Unclassified 1344
77 Ga0207687_10831178 3300025927 Bacteria 789
78 Ga0207690_10040919 3300025932 Bacteria 3033
79 Ga0207690_10049931 3300025932 Bacteria 2790
80 Ga0207706_10000053 3300025933 Bacteria 114286
81 Ga0207704_10000687 3300025938 Bacteria 14978
82 Ga0207661_10001144 3300025944 Bacteria 17701
83 Ga0207679_10000193 3300025945 Bacteria 49103
84 Ga0207667_10000005 3300025949 Bacteria 715503
85 Ga0207667_10000434 3300025949 Bacteria 56114
86 Ga0207667_10009853 3300025949 Bacteria 11221
87 Ga0207640_10426313 3300025981 Bacteria 1087
88 Ga0207702_10000190 3300026078 Bacteria 73848
89 Ga0207702_10763188 3300026078 Bacteria 955
90 Ga0207674_10000590 3300026116 Bacteria 47749
91 Ga0207698_10656701 3300026142 Bacteria 1039
92 Ga0209813_10000934 3300027866 Bacteria 6561
93 Ga0209974_10002242 3300027876 Bacteria 7027
94 Ga0314311_1210496 3300030733 Bacteria 2063
95 Ga0316178_1153280 3300030735 Bacteria 2432
96 Ga0316180_1183998 3300030736 Bacteria 2934
97 Ga0316183_1010007 3300030742 Bacteria 20400
98 Ga0316183_1056756 3300030742 Bacteria 10430
99 Ga0316183_1059735 3300030742 Unclassified 1304
100 Ga0316183_1072964 3300030742 Unclassified 1114
101 Ga0316183_1085329 3300030742 Unclassified 2034
102 Ga0316181_1063761 3300030744 Bacteria 284591
103 Ga0316181_1262238 3300030744 Unclassified 1856
104 Ga0316182_1038083 3300030745 Bacteria 7944
105 Ga0316182_1039048 3300030745 Bacteria 11178
106 Ga0316182_1229622 3300030745 Unclassified 888
107 Ga0316182_1407660 3300030745 Bacteria 9406
108 Ga0307406_10000002 3300031901 Bacteria 255753
109 Ga0307406_10002500 3300031901 Bacteria 10016
110 Ga0307414_10710257 3300032004 Unclassified 911
111 Ga0395899_0011870 3300037312 Bacteria 6671
112 Ga0395900_0000001 3300037418 Bacteria 931146
113 Ga0395898_0000002 3300037466 Bacteria 931013
114 Ga0395901_0000400 3300038443 Bacteria 51851
115 Ga0395901_0183116 3300038443 Unclassified 2197
116 Ga0439438_017707 3300041405 Bacteria 2043
117 Ga0439447_018362 3300041407 Bacteria 1887
118 Ga0439461_0010680 3300041410 Bacteria 1690
119 Ga0439461_0012884 3300041410 Bacteria 1570
120 Ga0439466_0029061 3300041411 Bacteria 1904
121 Ga0439442_014333 3300042002 Bacteria 1631
122 Ga0439432_001021 3300042006 Bacteria 10592
123 Ga0439432_092019 3300042006 Bacteria 912
124 Ga0450911_008373 3300042115 Bacteria 1475
125 Ga0450920_000342 3300042122 Bacteria 7137
126 Ga0450906_004039 3300042145 Bacteria 3104
127 Ga0439446_0000005 3300042156 Bacteria 101649
128 Ga0439446_0000181 3300042156 Bacteria 11104
129 Ga0450909_006297 3300042185 Bacteria 1711
130 Ga0439434_0018592 3300042435 Bacteria 2082
131 Ga0439434_0020252 3300042435 Bacteria 1996
132 Ga0439464_0000002 3300042439 Bacteria 79371
133 Ga0439464_0041579 3300042439 Bacteria 1311
134 Ga0450918_001386 3300042531 Bacteria 4852
135 Ga0450918_017426 3300042531 Bacteria 1250
136 Ga0466972_0195407 3300044658 Unclassified 948
137 Ga0466965_0000073 3300044683 Bacteria 29903
138 Ga0466970_0139613 3300044765 Unclassified 1334
139 Ga0495638_0000108 3300046460 Bacteria 132914
140 Ga0495638_0000173 3300046460 Bacteria 100531
141 Ga0495588_0056809 3300046674 Bacteria 2021
142 Ga0495660_0000035 3300046810 Bacteria 199140
143 Ga0496113_0093878 3300048916 Bacteria 2317
144 Ga0496115_0000273 3300048918 Bacteria 45346
145 Ga0496124_0338260 3300048927 Bacteria 1070
146 Ga0501034_0002158 3300049571 Bacteria 24404
147 nmdc:mga03683_65041_c1 3300050489 Bacteria 1549
148 nmdc:mga00v17_331_c1 3300050491 Bacteria 26647
149 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
150 nmdc:mga0k408_3447_c1 3300050493 Bacteria 8375
151 nmdc:mga06z11_1040_c1 3300050494 Bacteria 10098
152 nmdc:mga06z11_243502_c1 3300050494 Bacteria 1057
153 nmdc:mga04h51_19745_c1 3300050495 Bacteria 2002
154 nmdc:mga07m45_4477_c1 3300050496 Bacteria 6834
155 nmdc:mga07m45_60411_c1 3300050496 Bacteria 2145
156 nmdc:mga07m45_9685_c1 3300050496 Bacteria 5007
157 Ga0500646_0000001 3300053090 Bacteria 273936
158 Ga0500583_0026529 3300053092 Bacteria 2490
159 Ga0500583_0068169 3300053092 Bacteria 1696
160 Ga0500651_0434073 3300053093 Unclassified 733
161 Ga0500641_0000001 3300053096 Bacteria 1115973
162 Ga0500556_0053718 3300053104 Unclassified 1465
163 Ga0500569_000004 3300053109 Bacteria 100531
164 Ga0500594_0000111 3300053118 Bacteria 23911
165 Ga0500652_000001 3300053131 Bacteria 946868
166 Ga0500655_000207 3300053133 Bacteria 14178
167 Ga0500577_0007517 3300053142 Bacteria 3060
168 Ga0500577_0125844 3300053142 Unclassified 1070
169 Ga0500588_0000056 3300053146 Bacteria 19233
170 Ga0500616_0000067 3300053153 Bacteria 236311
171 Ga0500616_0047173 3300053153 Bacteria 2288
172 Ga0500620_036259 3300053155 Bacteria 1594
173 Ga0500613_000353 3300053738 Unclassified 2362
174 nmdc:mga0yw44_98_c1
175 MBSR1b_contig_12636410
176 MBSR1b_contig_5220965
177 JGI24740J21852_10001357
178 JGI24737J22298_10000814
179 JGI24743J22301_10010548
180 JGI24735J21928_10000107
181 rootH1_10023981
182 rootH2_10000659
183 rootH2_10302552
184 rootH1_10058345
185 JGI25405J52794_10007187
186 Ga0065715_10089232
187 Ga0070683_100001508
188 Ga0070670_100373573
189 Ga0070660_100000099
190 Ga0070660_100030588
191 Ga0070692_10017754
192 Ga0070675_100431069
193 Ga0070659_100015390
194 Ga0070662_100005004
195 Ga0070681_10112419
196 Ga0068855_100000138
197 Ga0068855_100000364
198 Ga0068855_100001636
199 Ga0070664_100001935
200 Ga0068857_100000117
201 Ga0068854_100058515
202 Ga0068856_100000354
203 Ga0068852_100768597
204 Ga0068863_100446199
205 Ga0081455_10000006
206 Ga0075365_10000091
207 Ga0075364_10000244
208 Ga0075367_10000110
209 Ga0075366_10000943
210 Ga0075370_10002351
211 Ga0075370_10039406
212 Ga0075370_10058625
213 Ga0075428_100061007
214 Ga0068865_100001723
215 Ga0105240_10000004
216 Ga0105240_10005031
217 Ga0105240_10009236
218 Ga0105245_10909075
219 Ga0105241_10674547
220 Ga0105237_10000001
221 Ga0105032_100003
222 Ga0105032_100022
223 Ga0105239_10001619
224 Ga0105239_10138957
225 Ga0105246_10002269
226 Ga0157373_10103659
227 Ga0157371_10024164
228 Ga0157371_10091224
229 Ga0157371_10528496
230 Ga0157370_10000706
231 Ga0157370_10001253
232 Ga0157370_10142153
233 Ga0157369_10000024
234 Ga0157369_10000444
235 Ga0157369_10002588
236 Ga0157374_10000501
237 Ga0157372_10000002
238 Ga0157372_10000008
239 Ga0157372_10020496
240 Ga0157377_10005025
241 Ga0207647_10000315
242 Ga0207707_10277804
243 Ga0207695_10000009
244 Ga0207695_10008875
245 Ga0207695_10040778
246 Ga0207671_10000003
247 Ga0207657_10001204
248 Ga0207657_10068646
249 Ga0207649_10223083
250 Ga0207687_10831178
251 Ga0207690_10040919
252 Ga0207690_10049931
253 Ga0207706_10000053
254 Ga0207704_10000687
255 Ga0207661_10001144
256 Ga0207679_10000193
257 Ga0207667_10000005
258 Ga0207667_10000434
259 Ga0207667_10009853
260 Ga0207640_10426313
261 Ga0207702_10000190
262 Ga0207702_10763188
263 Ga0207674_10000590
264 Ga0207698_10656701
265 Ga0209813_10000934
266 Ga0209974_10002242
267 Ga0314311_1210496
268 Ga0316178_1153280
269 Ga0316180_1183998
270 Ga0316183_1010007
271 Ga0316183_1056756
272 Ga0316183_1059735
273 Ga0316183_1072964
274 Ga0316183_1085329
275 Ga0316181_1063761
276 Ga0316181_1262238
277 Ga0316182_1038083
278 Ga0316182_1039048
279 Ga0316182_1229622
280 Ga0316182_1407660
281 Ga0307406_10000002
282 Ga0307406_10002500
283 Ga0307414_10710257
284 Ga0395899_0011870
285 Ga0395900_0000001
286 Ga0395898_0000002
287 Ga0395901_0000400
288 Ga0395901_0183116
289 Ga0439438_017707
290 Ga0439447_018362
291 Ga0439461_0010680
292 Ga0439461_0012884
293 Ga0439466_0029061
294 Ga0439442_014333
295 Ga0439432_001021
296 Ga0439432_092019
297 Ga0450911_008373
298 Ga0450920_000342
299 Ga0450906_004039
300 Ga0439446_0000005
301 Ga0439446_0000181
302 Ga0450909_006297
303 Ga0439434_0018592
304 Ga0439434_0020252
305 Ga0439464_0000002
306 Ga0439464_0041579
307 Ga0450918_001386
308 Ga0450918_017426
309 Ga0466972_0195407
310 Ga0466965_0000073
311 Ga0466970_0139613
312 Ga0495638_0000108
313 Ga0495638_0000173
314 Ga0495588_0056809
315 Ga0495660_0000035
316 Ga0496113_0093878
317 Ga0496115_0000273
318 Ga0496124_0338260
319 Ga0501034_0002158
320 nmdc:mga03683_65041_c1
321 nmdc:mga00v17_331_c1
322 nmdc:mga0yw44_6_c1
323 nmdc:mga0k408_3447_c1
324 nmdc:mga06z11_1040_c1
325 nmdc:mga06z11_243502_c1
326 nmdc:mga04h51_19745_c1
327 nmdc:mga07m45_4477_c1
328 nmdc:mga07m45_60411_c1
329 nmdc:mga07m45_9685_c1
330 Ga0500646_0000001
331 Ga0500583_0026529
332 Ga0500583_0068169
333 Ga0500651_0434073
334 Ga0500641_0000001
335 Ga0500556_0053718
336 Ga0500569_000004
337 Ga0500594_0000111
338 Ga0500652_000001
339 Ga0500655_000207
340 Ga0500577_0007517
341 Ga0500577_0125844
342 Ga0500588_0000056
343 Ga0500616_0000067
344 Ga0500616_0047173
345 Ga0500620_036259
346 Ga0500613_000353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

103

208

0.97

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

12

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9492 8 224
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9357 10 227
2dtn-assembly1.cif.gz_B crystal structure of helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate 0.9301 11 233
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9287 6 226
5hc8-assembly1.cif.gz_A crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate 0.9265 9 233
ID Description Score Start End Superfamily
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9386 7 225 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9357 9 232 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9332 9 225 3.40.1180.10
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9301 11 233 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9282 7 225 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A833D0S6-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9661 9 144 GO:0016094
GO:0045547
AF-A0A563C6S7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9656 8 161 GO:0008834
GO:0016094
GO:0045547
AF-X1FLT0-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9623 9 154 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A523VHM7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9614 9 174 GO:0008834
GO:0016094
GO:0045547
AF-A0A2M7XBG8-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9606 11 233 GO:0000287
GO:0016094
GO:0045547

Map