F264707

General Info

Members Datasets Scaffolds Average Seq Length
174 117 348 152

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10129158|Ga0207689_101291583
Length 171
Sequence MKPLETTVEEVLRKAIQSEVETRVYYQLLAERTTDDAVRRRMLELSDGELVHRAKLERKYREMVGSPPPAPEPVRIELPPDVADLTLRRALKHALERERDSESYFRHMAERIPPPTELGKLFVELGEMEWKHKTDLQGEYDRTAGSGDPERGEQPEHDHQHEDAAGPESPA

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 21.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10129158 3300025942 Bacteria 2079
2 Ga0065707_10165926 3300005295 Unclassified 1523
3 Ga0070683_100000009 3300005329 Bacteria 319830
4 Ga0070690_101403839 3300005330 Unclassified 562
5 Ga0070670_100378744 3300005331 Bacteria 1246
6 Ga0068869_100007177 3300005334 Bacteria 7103
7 Ga0070682_100000001 3300005337 Bacteria 569837
8 Ga0070682_100725254 3300005337 Unclassified 800
9 Ga0068868_100000551 3300005338 Bacteria 25173
10 Ga0068868_100001483 3300005338 Bacteria 16196
11 Ga0068868_101220098 3300005338 Unclassified 696
12 Ga0070689_100000331 3300005340 Bacteria 27580
13 Ga0070689_100317173 3300005340 Bacteria 1301
14 Ga0070689_100327118 3300005340 Bacteria 1281
15 Ga0070689_101476641 3300005340 Bacteria 615
16 Ga0070687_100243699 3300005343 Bacteria 1113
17 Ga0070687_101014406 3300005343 Unclassified 602
18 Ga0070692_10005915 3300005345 Bacteria 5267
19 Ga0070675_100000002 3300005354 Bacteria 435215
20 Ga0070675_100721325 3300005354 Bacteria 909
21 Ga0070671_100216578 3300005355 Bacteria 1624
22 Ga0070673_100023035 3300005364 Bacteria 4545
23 Ga0070688_100800658 3300005365 Unclassified 737
24 Ga0070709_10661405 3300005434 Bacteria 810
25 Ga0070714_100576443 3300005435 Bacteria 1079
26 Ga0070713_100023410 3300005436 Bacteria 4794
27 Ga0070701_10005164 3300005438 Bacteria 5365
28 Ga0070694_100935378 3300005444 Bacteria 717
29 Ga0070708_100079564 3300005445 Unclassified 2965
30 Ga0070678_100284079 3300005456 Bacteria 1400
31 Ga0070685_10043065 3300005466 Bacteria 2580
32 Ga0070706_100005306 3300005467 Bacteria 12285
33 Ga0070707_100008650 3300005468 Bacteria 9448
34 Ga0070707_100009142 3300005468 Bacteria 9191
35 Ga0070707_100085398 3300005468 Bacteria 3051
36 Ga0070698_100105599 3300005471 Unclassified 2786
37 Ga0070699_100117696 3300005518 Unclassified 2335
38 Ga0070699_100119427 3300005518 Bacteria 2317
39 Ga0070699_100136746 3300005518 Bacteria 2162
40 Ga0070684_100000641 3300005535 Bacteria 24048
41 Ga0070684_100261830 3300005535 Bacteria 1582
42 Ga0070672_100000113 3300005543 Bacteria 40820
43 Ga0070672_100324992 3300005543 Bacteria 1308
44 Ga0070686_100162005 3300005544 Bacteria 1576
45 Ga0070696_100458021 3300005546 Unclassified 1008
46 Ga0070693_100136468 3300005547 Unclassified 1539
47 Ga0070693_100152386 3300005547 Bacteria 1465
48 Ga0070704_101249335 3300005549 Bacteria 678
49 Ga0068857_100099253 3300005577 Bacteria 2612
50 Ga0068854_100000390 3300005578 Bacteria 27545
51 Ga0070702_100047232 3300005615 Bacteria 2445
52 Ga0070702_101183201 3300005615 Unclassified 615
53 Ga0068859_100942643 3300005617 Bacteria 947
54 Ga0068864_100000094 3300005618 Bacteria 92700
55 Ga0068851_10149447 3300005834 Bacteria 1276
56 Ga0068851_10535718 3300005834 Bacteria 706
57 Ga0068858_100000480 3300005842 Bacteria 41660
58 Ga0070717_10000371 3300006028 Bacteria 28681
59 Ga0070717_10564483 3300006028 Bacteria 1031
60 Ga0070716_100022858 3300006173 Unclassified 3309
61 Ga0070716_100044194 3300006173 Unclassified 2495
62 Ga0070716_100790913 3300006173 Unclassified 734
63 Ga0097621_100542554 3300006237 Unclassified 1058
64 Ga0075428_100045143 3300006844 Unclassified 4842
65 Ga0075428_100757153 3300006844 Unclassified 1033
66 Ga0075428_101231494 3300006844 Unclassified 788
67 Ga0075431_100018686 3300006847 Bacteria 7063
68 Ga0075431_100449596 3300006847 Bacteria 1284
69 Ga0075429_100605894 3300006880 Bacteria 960
70 Ga0075429_101547292 3300006880 Unclassified 577
71 Ga0068865_100077560 3300006881 Unclassified 2375
72 Ga0075436_100000534 3300006914 Bacteria 24765
73 Ga0097620_100942511 3300006931 Bacteria 947
74 Ga0075435_100000340 3300007076 Bacteria 28764
75 Ga0075435_100386771 3300007076 Unclassified 1202
76 Ga0111539_10000023 3300009094 Bacteria 211802
77 Ga0105245_10000003 3300009098 Bacteria 488207
78 Ga0105245_10002857 3300009098 Bacteria 15513
79 Ga0105245_10006631 3300009098 Bacteria 10165
80 Ga0105245_10910997 3300009098 Bacteria 921
81 Ga0105245_11147047 3300009098 Unclassified 824
82 Ga0105242_10002324 3300009176 Bacteria 14988
83 Ga0105248_10889455 3300009177 Bacteria 1005
84 Ga0105238_10000001 3300009551 Bacteria 2036163
85 Ga0105239_10090543 3300010375 Bacteria 3375
86 Ga0157369_10000156 3300013105 Bacteria 96474
87 Ga0157374_10000019 3300013296 Bacteria 280543
88 Ga0157378_10000286 3300013297 Bacteria 49248
89 Ga0157378_10015135 3300013297 Bacteria 6753
90 Ga0157378_10111449 3300013297 Bacteria 2509
91 Ga0163162_10209709 3300013306 Unclassified 2078
92 Ga0163162_10316850 3300013306 Unclassified 1692
93 Ga0157375_10000001 3300013308 Bacteria 696576
94 Ga0157375_10000004 3300013308 Bacteria 474935
95 Ga0157375_10000456 3300013308 Bacteria 37082
96 Ga0157380_10061203 3300014326 Bacteria 3011
97 Ga0157380_12274890 3300014326 Bacteria 606
98 Ga0157377_10000008 3300014745 Bacteria 394748
99 Ga0157377_10000222 3300014745 Bacteria 29706
100 Ga0157377_10206257 3300014745 Bacteria 1251
101 Ga0157376_10000118 3300014969 Bacteria 55480
102 Ga0213873_10001947 3300021358 Bacteria 3520
103 Ga0213876_10000077 3300021384 Bacteria 112133
104 Ga0213876_10167855 3300021384 Unclassified 1167
105 Ga0207656_10467324 3300025321 Bacteria 638
106 Ga0207699_10067382 3300025906 Bacteria 2176
107 Ga0207645_10423145 3300025907 Bacteria 897
108 Ga0207643_10110145 3300025908 Bacteria 1622
109 Ga0207684_10034712 3300025910 Bacteria 4285
110 Ga0207684_10471694 3300025910 Unclassified 1077
111 Ga0207662_10778520 3300025918 Bacteria 674
112 Ga0207646_10004313 3300025922 Bacteria 15517
113 Ga0207646_10017170 3300025922 Bacteria 6778
114 Ga0207646_10095979 3300025922 Bacteria 2656
115 Ga0207694_10000001 3300025924 Bacteria 4078485
116 Ga0207650_10029468 3300025925 Bacteria 3946
117 Ga0207659_10000005 3300025926 Bacteria 405839
118 Ga0207687_10000002 3300025927 Bacteria 975489
119 Ga0207687_10001311 3300025927 Bacteria 17007
120 Ga0207687_10003971 3300025927 Bacteria 9909
121 Ga0207687_10288409 3300025927 Bacteria 1318
122 Ga0207687_10698976 3300025927 Unclassified 860
123 Ga0207700_10010947 3300025928 Bacteria 5758
124 Ga0207664_10854683 3300025929 Bacteria 818
125 Ga0207644_10132521 3300025931 Bacteria 1910
126 Ga0207670_10000305 3300025936 Bacteria 29470
127 Ga0207704_10059111 3300025938 Bacteria 2365
128 Ga0207665_10121520 3300025939 Bacteria 1845
129 Ga0207665_10185238 3300025939 Bacteria 1510
130 Ga0207665_10265376 3300025939 Unclassified 1273
131 Ga0207691_10000287 3300025940 Bacteria 49690
132 Ga0207691_10221965 3300025940 Bacteria 1638
133 Ga0207711_11444766 3300025941 Unclassified 630
134 Ga0207689_10028860 3300025942 Bacteria 4639
135 Ga0207661_10000007 3300025944 Bacteria 471636
136 Ga0207661_10552387 3300025944 Bacteria 1055
137 Ga0207651_10102529 3300025960 Bacteria 2127
138 Ga0207640_10000983 3300025981 Bacteria 15807
139 Ga0207677_10000050 3300026023 Bacteria 100733
140 Ga0207677_10000195 3300026023 Bacteria 48707
141 Ga0207703_10000099 3300026035 Bacteria 103567
142 Ga0207639_10748899 3300026041 Unclassified 908
143 Ga0207676_10000063 3300026095 Bacteria 110993
144 Ga0207674_10008976 3300026116 Bacteria 11489
145 Ga0207698_10979535 3300026142 Bacteria 856
146 Ga0207428_10000003 3300027907 Bacteria 799783
147 Ga0307511_10004698 3300030521 Bacteria 13963
148 Ga0373932_0000049 3300035112 Bacteria 29089
149 Ga0373943_0096543 3300035170 Bacteria 1539
150 Ga0436365_0440833 3300039437 Bacteria 2898
151 Ga0436365_0732477 3300039437 Bacteria 196205
152 Ga0436362_1097862 3300039453 Bacteria 11860
153 Ga0451577_0002315 3300042876 Bacteria 23024
154 Ga0451577_0074988 3300042876 Bacteria 3017
155 Ga0451577_1463462 3300042876 Unclassified 605
156 Ga0453683_0929526 3300044673 Unclassified 576
157 Ga0466964_0158524 3300044706 Bacteria 1056
158 Ga0453684_0002491 3300044712 Bacteria 44502
159 Ga0451576_0227548 3300045051 Archaea 1947
160 Ga0451576_0599572 3300045051 Bacteria 1158
161 Ga0495620_0001591 3300046515 Bacteria 13453
162 Ga0495679_013572 3300047446 Bacteria 3051
163 Ga0496106_0127668 3300048909 Unclassified 1992
164 Ga0501072_0435341 3300049588 Unclassified 1039
165 Ga0501073_0012603 3300049589 Bacteria 6168
166 Ga0501080_0153931 3300049742 Unclassified 2124
167 Ga0501083_0975691 3300049744 Unclassified 551
168 nmdc:mga09592_524713_c1 3300050508 Unclassified 1018
169 nmdc:mga06r32_1535_c1 3300050510 Bacteria 20780
170 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
171 nmdc:mga0rr50_203702_c1 3300050513 Bacteria 1627
172 nmdc:mga0rr50_53_c1 3300050513 Bacteria 63727
173 nmdc:mga0rr50_93932_c1 3300050513 Bacteria 2341
174 nmdc:mga08x19_981_c1 3300050514 Bacteria 17831
175 Ga0207689_10129158
176 Ga0065707_10165926
177 Ga0070683_100000009
178 Ga0070690_101403839
179 Ga0070670_100378744
180 Ga0068869_100007177
181 Ga0070682_100000001
182 Ga0070682_100725254
183 Ga0068868_100000551
184 Ga0068868_100001483
185 Ga0068868_101220098
186 Ga0070689_100000331
187 Ga0070689_100317173
188 Ga0070689_100327118
189 Ga0070689_101476641
190 Ga0070687_100243699
191 Ga0070687_101014406
192 Ga0070692_10005915
193 Ga0070675_100000002
194 Ga0070675_100721325
195 Ga0070671_100216578
196 Ga0070673_100023035
197 Ga0070688_100800658
198 Ga0070709_10661405
199 Ga0070714_100576443
200 Ga0070713_100023410
201 Ga0070701_10005164
202 Ga0070694_100935378
203 Ga0070708_100079564
204 Ga0070678_100284079
205 Ga0070685_10043065
206 Ga0070706_100005306
207 Ga0070707_100008650
208 Ga0070707_100009142
209 Ga0070707_100085398
210 Ga0070698_100105599
211 Ga0070699_100117696
212 Ga0070699_100119427
213 Ga0070699_100136746
214 Ga0070684_100000641
215 Ga0070684_100261830
216 Ga0070672_100000113
217 Ga0070672_100324992
218 Ga0070686_100162005
219 Ga0070696_100458021
220 Ga0070693_100136468
221 Ga0070693_100152386
222 Ga0070704_101249335
223 Ga0068857_100099253
224 Ga0068854_100000390
225 Ga0070702_100047232
226 Ga0070702_101183201
227 Ga0068859_100942643
228 Ga0068864_100000094
229 Ga0068851_10149447
230 Ga0068851_10535718
231 Ga0068858_100000480
232 Ga0070717_10000371
233 Ga0070717_10564483
234 Ga0070716_100022858
235 Ga0070716_100044194
236 Ga0070716_100790913
237 Ga0097621_100542554
238 Ga0075428_100045143
239 Ga0075428_100757153
240 Ga0075428_101231494
241 Ga0075431_100018686
242 Ga0075431_100449596
243 Ga0075429_100605894
244 Ga0075429_101547292
245 Ga0068865_100077560
246 Ga0075436_100000534
247 Ga0097620_100942511
248 Ga0075435_100000340
249 Ga0075435_100386771
250 Ga0111539_10000023
251 Ga0105245_10000003
252 Ga0105245_10002857
253 Ga0105245_10006631
254 Ga0105245_10910997
255 Ga0105245_11147047
256 Ga0105242_10002324
257 Ga0105248_10889455
258 Ga0105238_10000001
259 Ga0105239_10090543
260 Ga0157369_10000156
261 Ga0157374_10000019
262 Ga0157378_10000286
263 Ga0157378_10015135
264 Ga0157378_10111449
265 Ga0163162_10209709
266 Ga0163162_10316850
267 Ga0157375_10000001
268 Ga0157375_10000004
269 Ga0157375_10000456
270 Ga0157380_10061203
271 Ga0157380_12274890
272 Ga0157377_10000008
273 Ga0157377_10000222
274 Ga0157377_10206257
275 Ga0157376_10000118
276 Ga0213873_10001947
277 Ga0213876_10000077
278 Ga0213876_10167855
279 Ga0207656_10467324
280 Ga0207699_10067382
281 Ga0207645_10423145
282 Ga0207643_10110145
283 Ga0207684_10034712
284 Ga0207684_10471694
285 Ga0207662_10778520
286 Ga0207646_10004313
287 Ga0207646_10017170
288 Ga0207646_10095979
289 Ga0207694_10000001
290 Ga0207650_10029468
291 Ga0207659_10000005
292 Ga0207687_10000002
293 Ga0207687_10001311
294 Ga0207687_10003971
295 Ga0207687_10288409
296 Ga0207687_10698976
297 Ga0207700_10010947
298 Ga0207664_10854683
299 Ga0207644_10132521
300 Ga0207670_10000305
301 Ga0207704_10059111
302 Ga0207665_10121520
303 Ga0207665_10185238
304 Ga0207665_10265376
305 Ga0207691_10000287
306 Ga0207691_10221965
307 Ga0207711_11444766
308 Ga0207689_10028860
309 Ga0207661_10000007
310 Ga0207661_10552387
311 Ga0207651_10102529
312 Ga0207640_10000983
313 Ga0207677_10000050
314 Ga0207677_10000195
315 Ga0207703_10000099
316 Ga0207639_10748899
317 Ga0207676_10000063
318 Ga0207674_10008976
319 Ga0207698_10979535
320 Ga0207428_10000003
321 Ga0307511_10004698
322 Ga0373932_0000049
323 Ga0373943_0096543
324 Ga0436365_0440833
325 Ga0436365_0732477
326 Ga0436362_1097862
327 Ga0451577_0002315
328 Ga0451577_0074988
329 Ga0451577_1463462
330 Ga0453683_0929526
331 Ga0466964_0158524
332 Ga0453684_0002491
333 Ga0451576_0227548
334 Ga0451576_0599572
335 Ga0495620_0001591
336 Ga0495679_013572
337 Ga0496106_0127668
338 Ga0501072_0435341
339 Ga0501073_0012603
340 Ga0501080_0153931
341 Ga0501083_0975691
342 nmdc:mga09592_524713_c1
343 nmdc:mga06r32_1535_c1
344 nmdc:mga08y16_4_c1
345 nmdc:mga0rr50_203702_c1
346 nmdc:mga0rr50_53_c1
347 nmdc:mga0rr50_93932_c1
348 nmdc:mga08x19_981_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02915

Rubrerythrin

Rubrerythrin

10

140

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5k-assembly1.cif.gz_B m. xanthus ferritin-like protein encb 0.936 7 65
7s5c-assembly1.cif.gz_E m. xanthus ferritin-like protein encb 0.8505 85 144
7s5k-assembly1.cif.gz_B m. xanthus ferritin-like protein encb 0.8429 7 65
4pk7-assembly1.cif.gz_A crystal structure of human stromal antigen 2 (sa2) in complex with sister chromatid cohesion protein 1 (scc1) with bound mes, native proteins 0.8401 87 142
7s5c-assembly1.cif.gz_I m. xanthus ferritin-like protein encb 0.8371 85 144
ID Description Score Start End Superfamily
af_A0A140LFX3_169_328_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8465 90 142 1.25.40.10
3tklB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8075 85 144 1.20.58.90
5n5fB00 Special;Helix non-globular;Helix Hairpins; 0.8038 2 63 6.10.140.1960
af_A0A1D6GXX4_27_139_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7982 85 142 1.20.140.40
5n5fC00 Special;Helix non-globular;Helix Hairpins; 0.7953 1 63 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A2V7XNL8-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9597 1 122 GO:0016491
GO:0046872
AF-A0A2V7XNL8-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9447 1 122 GO:0016491
GO:0046872
AF-A0A2V7YN65-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9441 1 153 GO:0016491
GO:0046872
AF-A0A2V7YN65-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9381 1 153 GO:0016491
GO:0046872
AF-A0A7Y5UVL3-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-independent) (EC 5.4.2.12) 0.8682 1 142 GO:0005829
GO:0006007
GO:0006096
GO:0016491
GO:0030145
GO:0046537

Map