F264722

General Info

Members Datasets Scaffolds Average Seq Length
174 122 168 161

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10000194|Ga0207702_1000019460
Length 182
Sequence MLKISRYARNDIIQDMTEKQLKLRIRIWLVLFIVGLALSGITAFPIETELAFLVRHSAVFPATVAAWITTVYNAVHTTNMAYPYLAYGTDWLAFGHLVIATSFIGPLKDPVRNIWVLQYGMIACVMVFPLAFIAGPVRGIPVYWRLVDCSFGFFGIIPLWICYRDIRKLEKLQNSRTAQAKK

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
101 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
119 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
120 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 0
Rhizoplane 0.57
Rhizosphere 80.46
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002579 3300001990 Bacteria 6430
2 JGI24735J21928_10000007 3300002067 Bacteria 333510
3 JGI25162J39368_1000086 3300002737 Bacteria 107401
4 JGI25157J39369_1006037 3300002741 Bacteria 1894
5 rootH1_10052309 3300003316 Bacteria 10629
6 rootH2_10020924 3300003320 Bacteria 14895
7 rootL2_10086250 3300003322 Bacteria 3966
8 rootL2_10151909 3300003322 Unclassified 1457
9 JGI25160J50197_1005084 3300003354 Bacteria 5545
10 Ga0055531_10000258 3300003794 Bacteria 56433
11 Ga0065714_10040269 3300005288 Bacteria 839
12 Ga0065714_10145734 3300005288 Bacteria 1122
13 Ga0070658_10163841 3300005327 Unclassified 1866
14 Ga0070658_10201776 3300005327 Bacteria 1678
15 Ga0070680_100018938 3300005336 Bacteria 5447
16 Ga0070667_100019475 3300005367 Bacteria 5631
17 Ga0070714_100367227 3300005435 Bacteria 1354
18 Ga0068867_100583743 3300005459 Bacteria 972
19 Ga0068853_100430765 3300005539 Bacteria 1238
20 Ga0070672_100332790 3300005543 Bacteria 1292
21 Ga0070665_101039123 3300005548 Bacteria 831
22 Ga0068855_100000139 3300005563 Bacteria 92537
23 Ga0068855_100010580 3300005563 Bacteria 11125
24 Ga0068855_100162687 3300005563 Bacteria 2532
25 Ga0068855_100249047 3300005563 Bacteria 1982
26 Ga0068854_100052014 3300005578 Bacteria 2936
27 Ga0068856_100001484 3300005614 Bacteria 24533
28 Ga0068856_100147651 3300005614 Unclassified 2359
29 Ga0068856_100303630 3300005614 Unclassified 1614
30 Ga0075366_10001232 3300006195 Bacteria 12699
31 Ga0075366_10031385 3300006195 Bacteria 3126
32 Ga0097621_100489958 3300006237 Bacteria 1112
33 Ga0075370_10485120 3300006353 Bacteria 745
34 Ga0105240_10007356 3300009093 Bacteria 16021
35 Ga0105240_10077112 3300009093 Bacteria 4107
36 Ga0105240_10082627 3300009093 Bacteria 3944
37 Ga0105241_10776652 3300009174 Bacteria 881
38 Ga0105237_10001248 3300009545 Bacteria 33954
39 Ga0105237_10016444 3300009545 Bacteria 7685
40 Ga0105237_10027349 3300009545 Bacteria 5823
41 Ga0105237_10027363 3300009545 Bacteria 5821
42 Ga0105237_10323715 3300009545 Bacteria 1545
43 Ga0105237_10334363 3300009545 Bacteria 1519
44 Ga0105238_10180229 3300009551 Bacteria 2089
45 Ga0105238_10823727 3300009551 Bacteria 944
46 Ga0105239_10000095 3300010375 Bacteria 124330
47 Ga0105239_10001041 3300010375 Bacteria 38642
48 Ga0105239_10002044 3300010375 Bacteria 26166
49 Ga0105239_10003429 3300010375 Bacteria 19422
50 Ga0157370_10257146 3300013104 Bacteria 1614
51 Ga0157370_10258383 3300013104 Bacteria 1610
52 Ga0157370_10471995 3300013104 Bacteria 1153
53 Ga0157369_10036266 3300013105 Bacteria 5404
54 Ga0157374_10015257 3300013296 Bacteria 6738
55 Ga0157374_10314690 3300013296 Bacteria 1550
56 Ga0157378_10070923 3300013297 Bacteria 3128
57 Ga0163162_10229575 3300013306 Bacteria 1986
58 Ga0163162_10417972 3300013306 Bacteria 1473
59 Ga0157372_10002401 3300013307 Bacteria 20287
60 Ga0157376_11655378 3300014969 Bacteria 675
61 Ga0163161_10137772 3300017792 Unclassified 1846
62 Ga0209437_100144 3300025233 Bacteria 164794
63 Ga0209026_1000250 3300025250 Bacteria 68451
64 Ga0209455_1004377 3300025272 Unclassified 4651
65 Ga0207426_1000023 3300025302 Bacteria 545465
66 Ga0209257_1000008 3300025304 Bacteria 1294570
67 Ga0207705_10125697 3300025909 Unclassified 1906
68 Ga0207705_10128046 3300025909 Bacteria 1888
69 Ga0207705_10198240 3300025909 Bacteria 1521
70 Ga0207654_10587062 3300025911 Unclassified 794
71 Ga0207695_10009933 3300025913 Bacteria 11696
72 Ga0207671_10001727 3300025914 Bacteria 24601
73 Ga0207671_10003672 3300025914 Bacteria 15133
74 Ga0207671_10018106 3300025914 Bacteria 5412
75 Ga0207671_10065260 3300025914 Unclassified 2707
76 Ga0207660_10057691 3300025917 Bacteria 2781
77 Ga0207694_10158829 3300025924 Bacteria 1825
78 Ga0207667_10000033 3300025949 Bacteria 314353
79 Ga0207667_10002580 3300025949 Bacteria 22502
80 Ga0207667_10712234 3300025949 Bacteria 1006
81 Ga0207640_10045819 3300025981 Bacteria 2811
82 Ga0207702_10000194 3300026078 Bacteria 71816
83 Ga0207702_10256167 3300026078 Unclassified 1646
84 Ga0207641_10142759 3300026088 Unclassified 2162
85 Ga0207698_11126410 3300026142 Bacteria 798
86 Ga0268264_10029765 3300028381 Bacteria 4475
87 Ga0307515_10000790 3300028794 Bacteria 72891
88 Ga0307515_10001523 3300028794 Bacteria 51822
89 Ga0265338_10515294 3300028800 Bacteria 841
90 Ga0307509_10109345 3300031507 Bacteria 2775
91 Ga0307408_100000700 3300031548 Bacteria 27358
92 Ga0265314_10059520 3300031711 Bacteria 2613
93 Ga0265342_10325012 3300031712 Bacteria 805
94 Ga0307516_10374125 3300031730 Unclassified 1087
95 Ga0307412_10263589 3300031911 Bacteria 1345
96 Ga0307409_101090282 3300031995 Bacteria 819
97 Ga0307507_10000078 3300033179 Bacteria 151026
98 Ga0451793_0891905 3300041452 Unclassified 1560
99 Ga0439449_0055896 3300042007 Bacteria 1458
100 Ga0466966_0276199 3300044684 Bacteria 1011
101 Ga0466959_0036822 3300045049 Bacteria 3615
102 Ga0495629_0307121 3300046459 Bacteria 1086
103 Ga0495638_0121568 3300046460 Bacteria 1542
104 Ga0495638_0187063 3300046460 Bacteria 1177
105 Ga0495651_0148006 3300046462 Bacteria 1696
106 Ga0495650_0001113 3300046471 Bacteria 29412
107 Ga0495585_0001275 3300046492 Bacteria 20152
108 Ga0495585_0001288 3300046492 Bacteria 19979
109 Ga0495583_0012217 3300046506 Bacteria 4875
110 Ga0495606_0000450 3300046507 Bacteria 67219
111 Ga0495606_0039902 3300046507 Bacteria 3158
112 Ga0495606_0063353 3300046507 Bacteria 2357
113 Ga0495610_0001531 3300046512 Bacteria 20373
114 Ga0495616_0004643 3300046513 Bacteria 8622
115 Ga0495616_0015268 3300046513 Bacteria 4272
116 Ga0495616_0264885 3300046513 Bacteria 734
117 Ga0495631_0072937 3300046518 Bacteria 1483
118 Ga0495632_0153180 3300046519 Bacteria 1065
119 Ga0495648_0022072 3300046524 Bacteria 4392
120 Ga0495648_0095170 3300046524 Bacteria 1657
121 Ga0495652_0096631 3300046529 Unclassified 2405
122 Ga0495654_0076733 3300046530 Bacteria 1574
123 Ga0495609_0006659 3300046538 Bacteria 5864
124 Ga0495609_0163003 3300046538 Bacteria 944
125 Ga0495622_0120213 3300046557 Bacteria 1199
126 Ga0495633_0000074 3300046558 Bacteria 130197
127 Ga0495633_0008710 3300046558 Bacteria 5688
128 Ga0495668_0000017 3300046616 Bacteria 434025
129 Ga0495611_0159718 3300046648 Bacteria 1053
130 Ga0495625_0000007 3300046660 Bacteria 565749
131 Ga0495625_0000435 3300046660 Bacteria 62758
132 Ga0495625_0000628 3300046660 Bacteria 51089
133 Ga0495625_0006470 3300046660 Bacteria 10415
134 Ga0495625_0070357 3300046660 Bacteria 2456
135 Ga0495625_0275636 3300046660 Bacteria 1084
136 Ga0495661_0021063 3300046665 Bacteria 4253
137 Ga0495661_0464986 3300046665 Bacteria 607
138 Ga0495658_0137750 3300046683 Bacteria 1491
139 Ga0495649_0000007 3300046694 Bacteria 518037
140 Ga0495589_0277680 3300046794 Bacteria 779
141 Ga0495660_0004064 3300046810 Bacteria 8933
142 Ga0495660_0079756 3300046810 Bacteria 1719
143 Ga0495679_103026 3300047446 Bacteria 791
144 Ga0495673_0018503 3300047469 Bacteria 3510
145 Ga0495686_0083629 3300047472 Bacteria 1946
146 Ga0495686_0095964 3300047472 Bacteria 1795
147 Ga0495614_0027105 3300048089 Bacteria 2471
148 Ga0496126_0008710 3300048929 Bacteria 10895
149 Ga0495678_036621 3300049459 Bacteria 2000
150 Ga0495682_0011853 3300049460 Bacteria 3351
151 Ga0501033_0015398 3300049570 Bacteria 5802
152 Ga0501034_0018113 3300049571 Bacteria 7227
153 Ga0501036_0121374 3300049572 Bacteria 2207
154 Ga0501037_0361967 3300049573 Bacteria 999
155 Ga0501043_0083957 3300049579 Bacteria 2503
156 Ga0501046_0139506 3300049580 Bacteria 1835
157 Ga0501047_0025468 3300049581 Bacteria 5687
158 Ga0501035_0077925 3300049822 Bacteria 2929
159 Ga0501044_0031388 3300049823 Bacteria 5592
160 nmdc:mga0k408_11652_c1 3300050493 Bacteria 4792
161 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
162 nmdc:mga07m45_389801_c1 3300050496 Bacteria 809
163 Ga0500608_061074 3300053122 Bacteria 1801
164 Ga0500618_000020 3300053125 Bacteria 161356
165 Ga0500561_0077649 3300053137 Bacteria 962
166 Ga0500616_0015219 3300053153 Bacteria 4403
167 Ga0500616_0096596 3300053153 Unclassified 1452
168 Ga0500622_0000493 3300053156 Bacteria 36875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0008710 Ga0496126_0008710_8720_9205 135
2 3300025909 Ga0207705_10198240 Ga0207705_101982402 146
3 3300005548 Ga0070665_101039123 Ga0070665_1010391232 149
4 3300005563 Ga0068855_100010580 Ga0068855_1000105806 149
5 3300025272 Ga0209455_1004377 Ga0209455_10043771 149
6 3300025949 Ga0207667_10002580 Ga0207667_100025806 149
7 3300005614 Ga0068856_100303630 Ga0068856_1003036302 150
8 3300026078 Ga0207702_10256167 Ga0207702_102561672 150
9 3300031507 Ga0307509_10109345 Ga0307509_101093453 150
10 3300046529 Ga0495652_0096631 Ga0495652_0096631_1642_2133 150
11 3300003794 Ga0055531_10000258 Ga0055531_1000025847 151
12 3300025304 Ga0209257_1000008 Ga0209257_1000008848 151
13 3300005435 Ga0070714_100367227 Ga0070714_1003672271 152
14 3300009093 Ga0105240_10007356 Ga0105240_100073563 152
15 3300009174 Ga0105241_10776652 Ga0105241_107766522 152
16 3300009545 Ga0105237_10016444 Ga0105237_100164447 152
17 3300009551 Ga0105238_10823727 Ga0105238_108237271 152
18 3300010375 Ga0105239_10003429 Ga0105239_100034292 152
19 3300025911 Ga0207654_10587062 Ga0207654_105870621 152
20 3300025913 Ga0207695_10009933 Ga0207695_1000993310 152
21 3300025914 Ga0207671_10065260 Ga0207671_100652602 152
22 3300025949 Ga0207667_10712234 Ga0207667_107122341 152
23 3300003322 rootL2_10086250 rootL2_100862502 154
24 3300002741 JGI25157J39369_1006037 JGI25157J39369_10060373 155
25 3300013296 Ga0157374_10314690 Ga0157374_103146902 155
26 3300025250 Ga0209026_1000250 Ga0209026_100025073 155
27 3300031548 Ga0307408_100000700 Ga0307408_10000070018 156
28 3300031995 Ga0307409_101090282 Ga0307409_1010902822 156
29 3300044684 Ga0466966_0276199 Ga0466966_0276199_315_788 157
30 3300045049 Ga0466959_0036822 Ga0466959_0036822_2868_3341 157
31 3300046507 Ga0495606_0039902 Ga0495606_0039902_1748_2221 157
32 3300013104 Ga0157370_10258383 Ga0157370_102583832 158
33 3300026088 Ga0207641_10142759 Ga0207641_101427592 158
34 3300049570 Ga0501033_0015398 Ga0501033_0015398_1176_1673 158
35 3300049571 Ga0501034_0018113 Ga0501034_0018113_1176_1673 158
36 3300049572 Ga0501036_0121374 Ga0501036_0121374_452_949 158
37 3300049573 Ga0501037_0361967 Ga0501037_0361967_408_905 158
38 3300049579 Ga0501043_0083957 Ga0501043_0083957_528_1025 158
39 3300049580 Ga0501046_0139506 Ga0501046_0139506_163_660 158
40 3300049581 Ga0501047_0025468 Ga0501047_0025468_1176_1673 158
41 3300049822 Ga0501035_0077925 Ga0501035_0077925_167_664 158
42 3300049823 Ga0501044_0031388 Ga0501044_0031388_1176_1673 158
43 iso_pu_bacteria 2852623160 2852625704 158
44 iso_pu_bacteria 2884933994 2884935771 158
45 3300003320 rootH2_10020924 rootH2_100209244 159
46 3300006195 Ga0075366_10001232 Ga0075366_100012326 159
47 3300006353 Ga0075370_10485120 Ga0075370_104851201 159
48 3300013306 Ga0163162_10417972 Ga0163162_104179722 159
49 3300028794 Ga0307515_10000790 Ga0307515_1000079017 159
50 3300028794 Ga0307515_10001523 Ga0307515_1000152322 159
51 3300031711 Ga0265314_10059520 Ga0265314_100595202 159
52 3300033179 Ga0307507_10000078 Ga0307507_10000078113 159
53 3300046459 Ga0495629_0307121 Ga0495629_0307121_359_838 159
54 3300046462 Ga0495651_0148006 Ga0495651_0148006_1013_1492 159
55 3300046492 Ga0495585_0001288 Ga0495585_0001288_16873_17352 159
56 3300046513 Ga0495616_0264885 Ga0495616_0264885_173_652 159
57 3300046518 Ga0495631_0072937 Ga0495631_0072937_394_873 159
58 3300046524 Ga0495648_0022072 Ga0495648_0022072_769_1248 159
59 3300046524 Ga0495648_0095170 Ga0495648_0095170_793_1272 159
60 3300046530 Ga0495654_0076733 Ga0495654_0076733_607_1086 159
61 3300046538 Ga0495609_0006659 Ga0495609_0006659_481_960 159
62 3300046557 Ga0495622_0120213 Ga0495622_0120213_649_1128 159
63 3300046558 Ga0495633_0000074 Ga0495633_0000074_117161_117640 159
64 3300046616 Ga0495668_0000017 Ga0495668_0000017_276980_277459 159
65 3300046660 Ga0495625_0000435 Ga0495625_0000435_9644_10123 159
66 3300046660 Ga0495625_0000628 Ga0495625_0000628_5257_5736 159
67 3300046683 Ga0495658_0137750 Ga0495658_0137750_149_628 159
68 3300046810 Ga0495660_0079756 Ga0495660_0079756_1057_1536 159
69 3300047472 Ga0495686_0083629 Ga0495686_0083629_945_1424 159
70 3300048089 Ga0495614_0027105 Ga0495614_0027105_665_1144 159
71 3300049460 Ga0495682_0011853 Ga0495682_0011853_1311_1790 159
72 3300050493 nmdc:mga0k408_424_c1 nmdc:mga0k408_424_c1_14046_14525 159
73 3300050496 nmdc:mga07m45_389801_c1 nmdc:mga07m45_389801_c1_254_733 159
74 3300053137 Ga0500561_0077649 Ga0500561_0077649_455_934 159
75 3300002737 JGI25162J39368_1000086 JGI25162J39368_100008670 160
76 3300003316 rootH1_10052309 rootH1_100523092 160
77 3300003322 rootL2_10151909 rootL2_101519091 160
78 3300003354 JGI25160J50197_1005084 JGI25160J50197_10050842 160
79 3300005288 Ga0065714_10145734 Ga0065714_101457342 160
80 3300005578 Ga0068854_100052014 Ga0068854_1000520144 160
81 3300009093 Ga0105240_10077112 Ga0105240_100771123 160
82 3300009093 Ga0105240_10082627 Ga0105240_100826274 160
83 3300009545 Ga0105237_10001248 Ga0105237_1000124813 160
84 3300009545 Ga0105237_10027349 Ga0105237_100273494 160
85 3300009545 Ga0105237_10027363 Ga0105237_100273634 160
86 3300009545 Ga0105237_10334363 Ga0105237_103343631 160
87 3300009551 Ga0105238_10180229 Ga0105238_101802292 160
88 3300010375 Ga0105239_10000095 Ga0105239_1000009529 160
89 3300010375 Ga0105239_10001041 Ga0105239_1000104110 160
90 3300010375 Ga0105239_10002044 Ga0105239_1000204410 160
91 3300013306 Ga0163162_10229575 Ga0163162_102295752 160
92 3300017792 Ga0163161_10137772 Ga0163161_101377721 160
93 3300025233 Ga0209437_100144 Ga0209437_10014439 160
94 3300025302 Ga0207426_1000023 Ga0207426_1000023384 160
95 3300025914 Ga0207671_10001727 Ga0207671_1000172717 160
96 3300025914 Ga0207671_10003672 Ga0207671_100036725 160
97 3300025914 Ga0207671_10018106 Ga0207671_100181064 160
98 3300025924 Ga0207694_10158829 Ga0207694_101588292 160
99 3300025981 Ga0207640_10045819 Ga0207640_100458194 160
100 3300026142 Ga0207698_11126410 Ga0207698_111264102 160
101 3300031730 Ga0307516_10374125 Ga0307516_103741252 160
102 3300042007 Ga0439449_0055896 Ga0439449_0055896_239_724 160
103 3300046460 Ga0495638_0121568 Ga0495638_0121568_276_758 160
104 3300046460 Ga0495638_0187063 Ga0495638_0187063_268_750 160
105 3300046492 Ga0495585_0001275 Ga0495585_0001275_18670_19152 160
106 3300046507 Ga0495606_0063353 Ga0495606_0063353_1739_2224 160
107 3300046513 Ga0495616_0015268 Ga0495616_0015268_1919_2401 160
108 3300046648 Ga0495611_0159718 Ga0495611_0159718_208_693 160
109 3300046660 Ga0495625_0006470 Ga0495625_0006470_1764_2249 160
110 3300046660 Ga0495625_0070357 Ga0495625_0070357_1034_1516 160
111 3300046660 Ga0495625_0275636 Ga0495625_0275636_178_663 160
112 3300046794 Ga0495589_0277680 Ga0495589_0277680_268_750 160
113 3300046810 Ga0495660_0004064 Ga0495660_0004064_5619_6101 160
114 3300047472 Ga0495686_0095964 Ga0495686_0095964_497_979 160
115 3300049459 Ga0495678_036621 Ga0495678_036621_297_779 160
116 3300053122 Ga0500608_061074 Ga0500608_061074_326_808 160
117 3300053125 Ga0500618_000020 Ga0500618_000020_141665_142147 160
118 3300053153 Ga0500616_0096596 Ga0500616_0096596_606_1091 160
119 3300053156 Ga0500622_0000493 Ga0500622_0000493_11230_11715 160
120 3300005336 Ga0070680_100018938 Ga0070680_1000189382 161
121 3300025917 Ga0207660_10057691 Ga0207660_100576912 161
122 3300053153 Ga0500616_0015219 Ga0500616_0015219_84_590 161
123 3300005563 Ga0068855_100162687 Ga0068855_1001626873 162
124 3300013296 Ga0157374_10015257 Ga0157374_100152572 162
125 3300046471 Ga0495650_0001113 Ga0495650_0001113_231_719 162
126 3300046506 Ga0495583_0012217 Ga0495583_0012217_219_707 162
127 3300046507 Ga0495606_0000450 Ga0495606_0000450_57469_57957 162
128 3300046512 Ga0495610_0001531 Ga0495610_0001531_18822_19310 162
129 3300046513 Ga0495616_0004643 Ga0495616_0004643_3891_4379 162
130 3300046519 Ga0495632_0153180 Ga0495632_0153180_238_726 162
131 3300046538 Ga0495609_0163003 Ga0495609_0163003_227_715 162
132 3300046558 Ga0495633_0008710 Ga0495633_0008710_4945_5433 162
133 3300046660 Ga0495625_0000007 Ga0495625_0000007_436515_437003 162
134 3300046665 Ga0495661_0021063 Ga0495661_0021063_3538_4026 162
135 3300046665 Ga0495661_0464986 Ga0495661_0464986_27_515 162
136 3300046694 Ga0495649_0000007 Ga0495649_0000007_479_967 162
137 3300047446 Ga0495679_103026 Ga0495679_103026_193_681 162
138 3300047469 Ga0495673_0018503 Ga0495673_0018503_2788_3276 162
139 iso_pu_bacteria 2919437846 2919439541 162
140 3300005367 Ga0070667_100019475 Ga0070667_1000194752 163
141 3300005459 Ga0068867_100583743 Ga0068867_1005837432 163
142 3300013297 Ga0157378_10070923 Ga0157378_100709234 163
143 3300028381 Ga0268264_10029765 Ga0268264_100297655 163
144 3300028800 Ga0265338_10515294 Ga0265338_105152942 163
145 iso_pu_bacteria 2928078545 2928081015 163
146 iso_pu_bacteria 2928147474 2928152568 163
147 iso_pu_bacteria 2932082852 2932087380 163
148 3300005288 Ga0065714_10040269 Ga0065714_100402692 164
149 3300005327 Ga0070658_10163841 Ga0070658_101638412 164
150 3300005539 Ga0068853_100430765 Ga0068853_1004307651 164
151 3300005543 Ga0070672_100332790 Ga0070672_1003327902 164
152 3300005563 Ga0068855_100000139 Ga0068855_1000001393 164
153 3300005614 Ga0068856_100147651 Ga0068856_1001476513 164
154 3300013104 Ga0157370_10257146 Ga0157370_102571461 164
155 3300014969 Ga0157376_11655378 Ga0157376_116553782 164
156 3300025909 Ga0207705_10125697 Ga0207705_101256972 164
157 3300025949 Ga0207667_10000033 Ga0207667_100000333 164
158 3300031911 Ga0307412_10263589 Ga0307412_102635892 164
159 3300041452 Ga0451793_0891905 Ga0451793_0891905_653_1150 164
160 3300006237 Ga0097621_100489958 Ga0097621_1004899581 165
161 3300005327 Ga0070658_10201776 Ga0070658_102017763 166
162 3300005614 Ga0068856_100001484 Ga0068856_10000148411 166
163 3300025909 Ga0207705_10128046 Ga0207705_101280463 166
164 3300001990 JGI24737J22298_10002579 JGI24737J22298_100025796 167
165 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000777 167
166 3300005563 Ga0068855_100249047 Ga0068855_1002490472 167
167 3300006195 Ga0075366_10031385 Ga0075366_100313852 167
168 3300009545 Ga0105237_10323715 Ga0105237_103237152 167
169 3300013104 Ga0157370_10471995 Ga0157370_104719951 167
170 3300013105 Ga0157369_10036266 Ga0157369_100362664 167
171 3300013307 Ga0157372_10002401 Ga0157372_100024015 167
172 3300026078 Ga0207702_10000194 Ga0207702_1000019460 167
173 3300031712 Ga0265342_10325012 Ga0265342_103250122 167
174 3300050493 nmdc:mga0k408_11652_c1 nmdc:mga0k408_11652_c1_1794_2297 167

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vjf-assembly2.cif.gz_C the p-loop k to a mutation of c. therm vps1 gtpase-bse 0.5188 75 154
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4898 1 149
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4834 1 149
7jic-assembly1.cif.gz_B structure of human cd19-cd81 co-receptor complex bound to coltuximab fab fragment 0.473 11 164
1r0d-assembly8.cif.gz_I hip1r thatch domain core 0.4318 8 164
ID Description Score Start End Superfamily
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6026 7 151 1.20.120.550
af_P0C672_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6023 8 123 1.20.5.110
af_A0A0R0G5K6_1_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5944 4 146 1.20.120.550
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5913 11 146 1.20.1280.290
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5856 7 151 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A172TZI8-F1-model_v4 Cytoplasmic membrane protein 0.9285 4 160 GO:0016020
AF-A0A1G4SPC4-F1-model_v4 SPW repeat-containing protein 0.8941 52 167 GO:0016020
AF-A0A6N4EGL2-F1-model_v4 deleted 0.8924 4 163
AF-A0A542KN76-F1-model_v4 EXPERA domain-containing protein 0.8873 1 158 GO:0016020
AF-A0A1K2FN43-F1-model_v4 EXPERA domain-containing protein 0.8869 4 166 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.74 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map