F264844

General Info

Members Datasets Scaffolds Average Seq Length
174 142 151 288

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10506487|Ga0307406_105064871
Length 257
Sequence MTSTQILETPAASLAYDVHGPLPTADGRPPLLLIGHPMDAGGFATLAELLPDRTVVTYDPRGLGRSSRHDGRSERTPEDNADDVHRIIAEIGGPVDLFLLALLPDADRAFAAERDVQAAYHDKGWGHGMAAFIALTSWQGEFPHESPAAPDPAAFGLPVEDNGSRDDPLLSGVSNAVTAYEPDIAAVQAAPTRVVVAVGEESQNLCTGRTSAALAEALGQEAVVFPGGHGGFMGGEFGYQGQPDAFAKRLREVLDTK

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
4 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
5 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
6 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
7 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
8 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
9 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
10 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
11 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
12 2858882152 Micromonospora noduli MED15 Isolate Nodule
13 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
14 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
15 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
16 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
17 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
18 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
19 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
20 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
21 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
93 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
142 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.78
Metatranscriptomes 0
Isolates 13.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 1.15
Rhizoplane 9.77
Rhizosphere 68.39
Stem 0
Stem Tuber 0
Unclassified 17.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008679 3300003203 Bacteria 4584
2 Ga0065714_10071451 3300005288 Bacteria 3564
3 Ga0070683_100005614 3300005329 Bacteria 10483
4 Ga0070683_100142739 3300005329 Bacteria 2268
5 Ga0070682_100031688 3300005337 Bacteria 3198
6 Ga0070687_100208625 3300005343 Bacteria 1188
7 Ga0070692_10046740 3300005345 Bacteria 2238
8 Ga0070668_100001845 3300005347 Bacteria 15440
9 Ga0070668_100396199 3300005347 Bacteria 1178
10 Ga0070668_100410419 3300005347 Bacteria 1158
11 Ga0070668_100531884 3300005347 Bacteria 1021
12 Ga0070671_100004519 3300005355 Bacteria 11015
13 Ga0070700_100002817 3300005441 Bacteria 8915
14 Ga0070663_100000772 3300005455 Bacteria 17456
15 Ga0068867_100042558 3300005459 Bacteria 3323
16 Ga0070685_10214538 3300005466 Bacteria 1258
17 Ga0070665_100002641 3300005548 Bacteria 19515
18 Ga0070665_100154077 3300005548 Bacteria 2300
19 Ga0070665_100700085 3300005548 Bacteria 1026
20 Ga0068852_100072416 3300005616 Bacteria 3028
21 Ga0068864_100408892 3300005618 Bacteria 1291
22 Ga0068861_100336135 3300005719 Bacteria 1320
23 Ga0068870_10018213 3300005840 Bacteria 3388
24 Ga0068863_100099227 3300005841 Bacteria 2767
25 Ga0068860_100012559 3300005843 Bacteria 8338
26 Ga0081539_10000162 3300005985 Bacteria 156292
27 Ga0075365_10207972 3300006038 Bacteria 1372
28 Ga0075364_10114889 3300006051 Bacteria 1799
29 Ga0075364_10256103 3300006051 Bacteria 1189
30 Ga0068871_100185443 3300006358 Bacteria 1790
31 Ga0075428_100495010 3300006844 Bacteria 1308
32 Ga0068865_100038780 3300006881 Bacteria 3226
33 Ga0111539_10049634 3300009094 Bacteria 5003
34 Ga0105245_10049489 3300009098 Bacteria 3764
35 Ga0114129_11035923 3300009147 Bacteria 1031
36 Ga0105248_10337052 3300009177 Bacteria 1698
37 Ga0105249_10569691 3300009553 Bacteria 1185
38 Ga0157375_10573889 3300013308 Bacteria 1288
39 Ga0163163_10325292 3300014325 Bacteria 1591
40 Ga0157377_10011913 3300014745 Bacteria 4356
41 Ga0157379_10009265 3300014968 Bacteria 8573
42 Ga0207688_10026954 3300025901 Bacteria 3161
43 Ga0207643_10006659 3300025908 Bacteria 6195
44 Ga0207687_10104412 3300025927 Bacteria 2092
45 Ga0207644_10007059 3300025931 Bacteria 7318
46 Ga0207704_10459551 3300025938 Bacteria 1018
47 Ga0207691_10000938 3300025940 Bacteria 28954
48 Ga0207711_10089311 3300025941 Bacteria 2707
49 Ga0207661_10004427 3300025944 Bacteria 9858
50 Ga0207661_10385880 3300025944 Bacteria 1268
51 Ga0207679_10045521 3300025945 Bacteria 3174
52 Ga0207668_10120882 3300025972 Bacteria 1983
53 Ga0207677_10143778 3300026023 Bacteria 1830
54 Ga0207678_10008050 3300026067 Bacteria 9295
55 Ga0207708_10000683 3300026075 Bacteria 25782
56 Ga0207641_10076379 3300026088 Bacteria 2896
57 Ga0207648_10001487 3300026089 Bacteria 25804
58 Ga0207676_10528554 3300026095 Bacteria 1124
59 Ga0207675_100001224 3300026118 Bacteria 25629
60 Ga0207698_10018087 3300026142 Bacteria 4796
61 Ga0207428_10351258 3300027907 Bacteria 1085
62 Ga0268266_10094556 3300028379 Bacteria 2623
63 Ga0268266_10149331 3300028379 Bacteria 2105
64 Ga0268266_10361025 3300028379 Bacteria 1367
65 Ga0268265_10326226 3300028380 Bacteria 1393
66 Ga0268264_10028730 3300028381 Bacteria 4551
67 Ga0307513_10015972 3300031456 Bacteria 9080
68 Ga0307408_100302296 3300031548 Bacteria 1341
69 Ga0307514_10141533 3300031649 Bacteria 1634
70 Ga0307413_10154717 3300031824 Bacteria 1602
71 Ga0307410_10018676 3300031852 Bacteria 4195
72 Ga0307410_10069822 3300031852 Bacteria 2431
73 Ga0307406_10000648 3300031901 Bacteria 19779
74 Ga0307406_10001084 3300031901 Bacteria 15146
75 Ga0307406_10053231 3300031901 Bacteria 2577
76 Ga0307406_10292585 3300031901 Bacteria 1247
77 Ga0307406_10506487 3300031901 Bacteria 980
78 Ga0307407_10030751 3300031903 Bacteria 2900
79 Ga0307409_100019004 3300031995 Bacteria 4640
80 Ga0307416_100035875 3300032002 Bacteria 3794
81 Ga0307416_100036812 3300032002 Bacteria 3758
82 Ga0307416_100822641 3300032002 Bacteria 1026
83 Ga0307414_10016968 3300032004 Bacteria 4444
84 Ga0307414_10178574 3300032004 Bacteria 1705
85 Ga0307415_100035241 3300032126 Bacteria 3267
86 Ga0307415_100447773 3300032126 Bacteria 1115
87 Ga0373946_0017599 3300035171 Bacteria 2736
88 Ga0436364_0451944 3300037853 Bacteria 3947
89 Ga0436364_0948511 3300037853 Bacteria 1031
90 Ga0436363_1174329 3300039450 Bacteria 2722
91 Ga0451835_0062986 3300041492 Bacteria 1055
92 Ga0451837_0484098 3300041494 Bacteria 1165
93 Ga0466964_0026407 3300044706 Bacteria 2273
94 Ga0466971_0037817 3300044719 Bacteria 2164
95 Ga0466970_0048781 3300044765 Bacteria 2258
96 Ga0466957_0008255 3300044842 Bacteria 5917
97 Ga0466957_0223189 3300044842 Bacteria 1245
98 Ga0466960_0098643 3300044901 Bacteria 1501
99 Ga0466958_0117260 3300045836 Bacteria 1665
100 Ga0466967_0003856 3300045976 Bacteria 9932
101 Ga0466967_0281499 3300045976 Bacteria 1596
102 Ga0495631_0102923 3300046518 Bacteria 1229
103 Ga0495666_0145732 3300046526 Bacteria 1102
104 Ga0495645_0154136 3300046543 Bacteria 1593
105 Ga0495658_0298540 3300046683 Bacteria 1018
106 Ga0495686_0078207 3300047472 Bacteria 2025
107 Ga0496100_0045037 3300048903 Bacteria 2829
108 Ga0496101_0006452 3300048904 Bacteria 7548
109 Ga0496104_0029358 3300048907 Bacteria 5100
110 Ga0496104_0237057 3300048907 Bacteria 1736
111 Ga0496105_0023474 3300048908 Bacteria 5003
112 Ga0496105_0144414 3300048908 Bacteria 1957
113 Ga0496107_0123768 3300048910 Bacteria 1906
114 Ga0496108_0000054 3300048911 Bacteria 125333
115 Ga0496109_0040389 3300048912 Bacteria 4226
116 Ga0496109_0158629 3300048912 Bacteria 2119
117 Ga0496109_0453078 3300048912 Bacteria 1212
118 Ga0496111_0100620 3300048914 Bacteria 2123
119 Ga0496114_0003033 3300048917 Bacteria 12879
120 Ga0496114_0068523 3300048917 Bacteria 2979
121 Ga0496114_0422520 3300048917 Bacteria 1181
122 Ga0496114_0834723 3300048917 Bacteria 801
123 Ga0496115_0073995 3300048918 Bacteria 2766
124 Ga0496117_0001897 3300048920 Bacteria 28066
125 Ga0496118_0110510 3300048921 Bacteria 1825
126 Ga0496119_0009892 3300048922 Bacteria 8099
127 Ga0496120_0008301 3300048923 Bacteria 7573
128 Ga0496121_0005814 3300048924 Bacteria 15638
129 Ga0496122_0021643 3300048925 Bacteria 5747
130 Ga0496123_0155789 3300048926 Bacteria 1225
131 Ga0496124_0006017 3300048927 Bacteria 13376
132 Ga0496125_0004665 3300048928 Bacteria 15628
133 Ga0496125_0016884 3300048928 Bacteria 6988
134 Ga0496125_0018755 3300048928 Bacteria 6557
135 Ga0496126_0014619 3300048929 Bacteria 7926
136 Ga0501031_0041084 3300049568 Bacteria 3020
137 Ga0501036_0033018 3300049572 Bacteria 4376
138 Ga0501038_0260991 3300049574 Bacteria 1369
139 Ga0501047_0577746 3300049581 Bacteria 947
140 Ga0501071_0015869 3300049587 Bacteria 5173
141 Ga0501072_0088086 3300049588 Bacteria 2463
142 Ga0501076_0048473 3300049592 Bacteria 3358
143 Ga0501079_0148118 3300049741 Bacteria 1830
144 Ga0501080_0450891 3300049742 Bacteria 1153
145 Ga0501081_0034435 3300049743 Bacteria 3446
146 Ga0501045_0120359 3300049824 Bacteria 1949
147 nmdc:mga00v17_92165_c1 3300050491 Bacteria 1904
148 nmdc:mga0yw44_157668_c1 3300050492 Bacteria 1484
149 nmdc:mga08y16_220714_c1 3300050511 Bacteria 1963
150 nmdc:mga08y16_330351_c1 3300050511 Bacteria 1568
151 Ga0530510_0202796 3300061734 Bacteria 1474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0422520 Ga0496114_0422520_27_800 256
2 3300048917 Ga0496114_0834723 Ga0496114_0834723_15_785 256
3 3300031901 Ga0307406_10506487 Ga0307406_105064871 257
4 3300035171 Ga0373946_0017599 Ga0373946_0017599_1906_2682 257
5 3300039450 Ga0436363_1174329 Ga0436363_1174329_350_1180 257
6 3300046526 Ga0495666_0145732 Ga0495666_0145732_304_1080 257
7 3300046543 Ga0495645_0154136 Ga0495645_0154136_20_796 257
8 3300046683 Ga0495658_0298540 Ga0495658_0298540_201_977 257
9 iso_pu_bacteria 2582580736 2583151667 281
10 iso_pu_bacteria 2643221724 2644678705 284
11 iso_pu_bacteria 2728369380 2730228208 284
12 iso_pu_bacteria 2747842429 2747955326 284
13 iso_pu_bacteria 2852677369 2852680539 284
14 iso_pu_bacteria 2857723135 2857725622 284
15 iso_pu_bacteria 2862993130 2862995947 284
16 iso_pu_bacteria 2939660829 2939661264 284
17 iso_pu_bacteria 2946080515 2946081940 284
18 3300005347 Ga0070668_100410419 Ga0070668_1004104191 285
19 3300005347 Ga0070668_100531884 Ga0070668_1005318841 285
20 3300005355 Ga0070671_100004519 Ga0070671_1000045198 285
21 3300005548 Ga0070665_100002641 Ga0070665_10000264111 285
22 3300005841 Ga0068863_100099227 Ga0068863_1000992273 285
23 3300005843 Ga0068860_100012559 Ga0068860_1000125595 285
24 3300025931 Ga0207644_10007059 Ga0207644_100070596 285
25 3300026088 Ga0207641_10076379 Ga0207641_100763792 285
26 3300028379 Ga0268266_10094556 Ga0268266_100945562 285
27 3300028381 Ga0268264_10028730 Ga0268264_100287302 285
28 3300031548 Ga0307408_100302296 Ga0307408_1003022962 285
29 3300031901 Ga0307406_10292585 Ga0307406_102925851 285
30 3300032002 Ga0307416_100035875 Ga0307416_1000358753 285
31 3300044842 Ga0466957_0223189 Ga0466957_0223189_223_1080 285
32 3300048911 Ga0496108_0000054 Ga0496108_0000054_100209_101072 286
33 iso_pu_bacteria 2818991462 2819691571 286
34 3300005347 Ga0070668_100396199 Ga0070668_1003961991 287
35 3300005455 Ga0070663_100000772 Ga0070663_1000007722 287
36 3300005548 Ga0070665_100700085 Ga0070665_1007000851 287
37 3300006051 Ga0075364_10114889 Ga0075364_101148892 287
38 3300014968 Ga0157379_10009265 Ga0157379_100092654 287
39 3300025972 Ga0207668_10120882 Ga0207668_101208822 287
40 3300026067 Ga0207678_10008050 Ga0207678_100080503 287
41 3300028379 Ga0268266_10361025 Ga0268266_103610251 287
42 3300031456 Ga0307513_10015972 Ga0307513_100159728 287
43 3300044765 Ga0466970_0048781 Ga0466970_0048781_313_1176 287
44 3300044901 Ga0466960_0098643 Ga0466960_0098643_173_1036 287
45 3300045976 Ga0466967_0281499 Ga0466967_0281499_395_1258 287
46 3300048903 Ga0496100_0045037 Ga0496100_0045037_321_1187 287
47 3300048904 Ga0496101_0006452 Ga0496101_0006452_5314_6180 287
48 3300048907 Ga0496104_0029358 Ga0496104_0029358_1345_2211 287
49 3300048908 Ga0496105_0023474 Ga0496105_0023474_780_1646 287
50 3300048912 Ga0496109_0158629 Ga0496109_0158629_54_920 287
51 3300048914 Ga0496111_0100620 Ga0496111_0100620_1179_2045 287
52 3300048922 Ga0496119_0009892 Ga0496119_0009892_4746_5612 287
53 3300048923 Ga0496120_0008301 Ga0496120_0008301_5195_6061 287
54 3300048924 Ga0496121_0005814 Ga0496121_0005814_2762_3628 287
55 3300048927 Ga0496124_0006017 Ga0496124_0006017_1269_2135 287
56 3300048928 Ga0496125_0016884 Ga0496125_0016884_4603_5469 287
57 3300049581 Ga0501047_0577746 Ga0501047_0577746_63_926 287
58 iso_pu_bacteria 2772190715 2772642998 287
59 iso_pu_bacteria 2855670206 2855673026 287
60 iso_pu_bacteria 2857288857 2857293783 287
61 iso_pu_bacteria 2858882152 2858884407 287
62 iso_pu_bacteria 2858895516 2858896797 287
63 iso_pu_bacteria 2869061728 2869063002 287
64 iso_pu_bacteria 2869068681 2869069169 287
65 iso_pu_bacteria 2880489317 2880491862 287
66 iso_pu_bacteria 2880495981 2880500439 287
67 iso_pu_bacteria 2929226422 2929228949 287
68 iso_pu_bacteria 8003830390 8003831106 287
69 iso_pu_bacteria 8003870546 8003873767 287
70 3300005288 Ga0065714_10071451 Ga0065714_100714512 288
71 3300005548 Ga0070665_100154077 Ga0070665_1001540772 288
72 3300006038 Ga0075365_10207972 Ga0075365_102079721 288
73 3300006051 Ga0075364_10256103 Ga0075364_102561031 288
74 3300006844 Ga0075428_100495010 Ga0075428_1004950102 288
75 3300009094 Ga0111539_10049634 Ga0111539_100496342 288
76 3300013308 Ga0157375_10573889 Ga0157375_105738892 288
77 3300027907 Ga0207428_10351258 Ga0207428_103512582 288
78 3300028379 Ga0268266_10149331 Ga0268266_101493313 288
79 3300031901 Ga0307406_10000648 Ga0307406_100006485 288
80 3300031901 Ga0307406_10001084 Ga0307406_1000108410 288
81 3300037853 Ga0436364_0451944 Ga0436364_0451944_1696_2562 288
82 3300041494 Ga0451837_0484098 Ga0451837_0484098_281_1147 288
83 3300046518 Ga0495631_0102923 Ga0495631_0102923_230_1096 288
84 3300047472 Ga0495686_0078207 Ga0495686_0078207_78_944 288
85 3300048920 Ga0496117_0001897 Ga0496117_0001897_21724_22590 288
86 3300048921 Ga0496118_0110510 Ga0496118_0110510_864_1730 288
87 3300048928 Ga0496125_0018755 Ga0496125_0018755_4667_5533 288
88 3300048929 Ga0496126_0014619 Ga0496126_0014619_2131_2997 288
89 3300050491 nmdc:mga00v17_92165_c1 nmdc:mga00v17_92165_c1_202_1068 288
90 3300050492 nmdc:mga0yw44_157668_c1 nmdc:mga0yw44_157668_c1_286_1152 288
91 3300050511 nmdc:mga08y16_220714_c1 nmdc:mga08y16_220714_c1_844_1710 288
92 3300050511 nmdc:mga08y16_330351_c1 nmdc:mga08y16_330351_c1_570_1436 288
93 3300005329 Ga0070683_100142739 Ga0070683_1001427392 289
94 3300005337 Ga0070682_100031688 Ga0070682_1000316882 289
95 3300005343 Ga0070687_100208625 Ga0070687_1002086252 289
96 3300005345 Ga0070692_10046740 Ga0070692_100467403 289
97 3300005347 Ga0070668_100001845 Ga0070668_10000184510 289
98 3300005441 Ga0070700_100002817 Ga0070700_1000028179 289
99 3300005459 Ga0068867_100042558 Ga0068867_1000425582 289
100 3300005466 Ga0070685_10214538 Ga0070685_102145381 289
101 3300005616 Ga0068852_100072416 Ga0068852_1000724161 289
102 3300005618 Ga0068864_100408892 Ga0068864_1004088921 289
103 3300005719 Ga0068861_100336135 Ga0068861_1003361352 289
104 3300005840 Ga0068870_10018213 Ga0068870_100182134 289
105 3300006358 Ga0068871_100185443 Ga0068871_1001854432 289
106 3300006881 Ga0068865_100038780 Ga0068865_1000387802 289
107 3300009098 Ga0105245_10049489 Ga0105245_100494892 289
108 3300009147 Ga0114129_11035923 Ga0114129_110359232 289
109 3300009177 Ga0105248_10337052 Ga0105248_103370522 289
110 3300009553 Ga0105249_10569691 Ga0105249_105696911 289
111 3300014325 Ga0163163_10325292 Ga0163163_103252922 289
112 3300014745 Ga0157377_10011913 Ga0157377_100119134 289
113 3300025901 Ga0207688_10026954 Ga0207688_100269543 289
114 3300025908 Ga0207643_10006659 Ga0207643_100066593 289
115 3300025927 Ga0207687_10104412 Ga0207687_101044122 289
116 3300025938 Ga0207704_10459551 Ga0207704_104595511 289
117 3300025940 Ga0207691_10000938 Ga0207691_1000093825 289
118 3300025941 Ga0207711_10089311 Ga0207711_100893112 289
119 3300025944 Ga0207661_10385880 Ga0207661_103858802 289
120 3300026023 Ga0207677_10143778 Ga0207677_101437782 289
121 3300026075 Ga0207708_10000683 Ga0207708_1000068324 289
122 3300026089 Ga0207648_10001487 Ga0207648_1000148727 289
123 3300026118 Ga0207675_100001224 Ga0207675_10000122422 289
124 3300026142 Ga0207698_10018087 Ga0207698_100180874 289
125 3300028380 Ga0268265_10326226 Ga0268265_103262262 289
126 3300031852 Ga0307410_10018676 Ga0307410_100186762 289
127 3300031901 Ga0307406_10053231 Ga0307406_100532312 289
128 3300032002 Ga0307416_100822641 Ga0307416_1008226411 289
129 3300032004 Ga0307414_10178574 Ga0307414_101785742 289
130 3300032126 Ga0307415_100447773 Ga0307415_1004477732 289
131 3300037853 Ga0436364_0948511 Ga0436364_0948511_138_1010 289
132 3300041492 Ga0451835_0062986 Ga0451835_0062986_27_902 289
133 3300044706 Ga0466964_0026407 Ga0466964_0026407_59_928 289
134 3300044719 Ga0466971_0037817 Ga0466971_0037817_555_1427 289
135 3300044842 Ga0466957_0008255 Ga0466957_0008255_115_987 289
136 3300045836 Ga0466958_0117260 Ga0466958_0117260_156_1028 289
137 3300045976 Ga0466967_0003856 Ga0466967_0003856_5918_6787 289
138 3300048910 Ga0496107_0123768 Ga0496107_0123768_110_985 289
139 3300048912 Ga0496109_0040389 Ga0496109_0040389_3167_4042 289
140 3300049568 Ga0501031_0041084 Ga0501031_0041084_1289_2158 289
141 3300049572 Ga0501036_0033018 Ga0501036_0033018_2638_3507 289
142 3300049574 Ga0501038_0260991 Ga0501038_0260991_267_1136 289
143 3300049587 Ga0501071_0015869 Ga0501071_0015869_1227_2096 289
144 3300049588 Ga0501072_0088086 Ga0501072_0088086_757_1626 289
145 3300049592 Ga0501076_0048473 Ga0501076_0048473_1691_2560 289
146 3300049741 Ga0501079_0148118 Ga0501079_0148118_748_1617 289
147 3300049742 Ga0501080_0450891 Ga0501080_0450891_27_896 289
148 3300049743 Ga0501081_0034435 Ga0501081_0034435_2117_2986 289
149 3300049824 Ga0501045_0120359 Ga0501045_0120359_644_1513 289
150 3300061734 Ga0530510_0202796 Ga0530510_0202796_553_1422 289
151 iso_pu_bacteria 2622736605 2623502049 289
152 3300048912 Ga0496109_0453078 Ga0496109_0453078_182_1054 290
153 3300048917 Ga0496114_0068523 Ga0496114_0068523_143_1021 290
154 3300048918 Ga0496115_0073995 Ga0496115_0073995_461_1336 290
155 3300005329 Ga0070683_100005614 Ga0070683_1000056145 291
156 3300025944 Ga0207661_10004427 Ga0207661_100044276 291
157 3300025945 Ga0207679_10045521 Ga0207679_100455212 291
158 3300031649 Ga0307514_10141533 Ga0307514_101415332 291
159 3300031824 Ga0307413_10154717 Ga0307413_101547172 291
160 3300031852 Ga0307410_10069822 Ga0307410_100698223 291
161 3300031903 Ga0307407_10030751 Ga0307407_100307513 291
162 3300031995 Ga0307409_100019004 Ga0307409_1000190045 291
163 3300032002 Ga0307416_100036812 Ga0307416_1000368123 291
164 3300032004 Ga0307414_10016968 Ga0307414_100169682 291
165 3300032126 Ga0307415_100035241 Ga0307415_1000352413 291
166 3300048907 Ga0496104_0237057 Ga0496104_0237057_107_997 291
167 3300048908 Ga0496105_0144414 Ga0496105_0144414_487_1377 291
168 3300048917 Ga0496114_0003033 Ga0496114_0003033_9098_9988 291
169 3300003203 JGI25406J46586_10008679 JGI25406J46586_100086793 292
170 3300005985 Ga0081539_10000162 Ga0081539_10000162103 292
171 3300026095 Ga0207676_10528554 Ga0207676_105285541 292
172 3300048925 Ga0496122_0021643 Ga0496122_0021643_738_1703 292
173 3300048926 Ga0496123_0155789 Ga0496123_0155789_132_1097 292
174 3300048928 Ga0496125_0004665 Ga0496125_0004665_3390_4355 292

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmd-assembly2.cif.gz_B crystal structure of epoxide hydrolase vreh1 from vigna radiata 0.8675 5 128
6ty7-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase variant dhaa115 domain-swapped dimer type-1 0.8343 6 125
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8324 6 125
6xtc-assembly2.cif.gz_D crystal structure of haloalkane dehalogenase variant dhaa177 domain-swapped dimer type-3 0.8319 6 125
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8286 6 125
ID Description Score Start End Superfamily
af_A0A0R4IK35_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9025 84 126 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8641 4 126 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8607 6 122 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8516 15 125 3.40.50.12270
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8512 19 122 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7K0CWU2-F1-model_v4 Alpha/beta hydrolase 0.9895 110 292
AF-K0ENF1-F1-model_v4 Hydrolase 0.9892 6 291 GO:0016787
AF-A0A845J666-F1-model_v4 Alpha/beta fold hydrolase 0.9862 36 289 GO:0016020
GO:0016787
AF-K0ENF1-F1-model_v4 Hydrolase 0.9823 6 291 GO:0016787
AF-A0A7K0CWU2-F1-model_v4 Alpha/beta hydrolase 0.9789 110 292

Feature Viewer

pLDDT pTM Quality
94.25 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map