F264844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 174 | 142 | 151 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10506487|Ga0307406_105064871 |
| Length | 257 |
| Sequence | MTSTQILETPAASLAYDVHGPLPTADGRPPLLLIGHPMDAGGFATLAELLPDRTVVTYDPRGLGRSSRHDGRSERTPEDNADDVHRIIAEIGGPVDLFLLALLPDADRAFAAERDVQAAYHDKGWGHGMAAFIALTSWQGEFPHESPAAPDPAAFGLPVEDNGSRDDPLLSGVSNAVTAYEPDIAAVQAAPTRVVVAVGEESQNLCTGRTSAALAEALGQEAVVFPGGHGGFMGGEFGYQGQPDAFAKRLREVLDTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 2 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 3 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 4 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 5 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 6 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 7 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 8 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 9 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 10 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 11 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 12 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 13 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 14 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 15 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 16 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 17 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 18 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 19 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 20 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 21 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 81 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 82 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 83 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 84 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 89 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 90 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 91 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 92 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 93 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 94 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 95 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 99 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 100 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 101 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 109 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 110 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 111 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 114 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 117 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 118 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 119 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 120 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 121 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 122 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 123 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 124 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 125 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 126 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 138 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 139 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 141 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 142 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.78 |
| Metatranscriptomes | 0 |
| Isolates | 13.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.87 |
| Nodule | 1.15 |
| Rhizoplane | 9.77 |
| Rhizosphere | 68.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10008679 | 3300003203 | Bacteria | 4584 |
| 2 | Ga0065714_10071451 | 3300005288 | Bacteria | 3564 |
| 3 | Ga0070683_100005614 | 3300005329 | Bacteria | 10483 |
| 4 | Ga0070683_100142739 | 3300005329 | Bacteria | 2268 |
| 5 | Ga0070682_100031688 | 3300005337 | Bacteria | 3198 |
| 6 | Ga0070687_100208625 | 3300005343 | Bacteria | 1188 |
| 7 | Ga0070692_10046740 | 3300005345 | Bacteria | 2238 |
| 8 | Ga0070668_100001845 | 3300005347 | Bacteria | 15440 |
| 9 | Ga0070668_100396199 | 3300005347 | Bacteria | 1178 |
| 10 | Ga0070668_100410419 | 3300005347 | Bacteria | 1158 |
| 11 | Ga0070668_100531884 | 3300005347 | Bacteria | 1021 |
| 12 | Ga0070671_100004519 | 3300005355 | Bacteria | 11015 |
| 13 | Ga0070700_100002817 | 3300005441 | Bacteria | 8915 |
| 14 | Ga0070663_100000772 | 3300005455 | Bacteria | 17456 |
| 15 | Ga0068867_100042558 | 3300005459 | Bacteria | 3323 |
| 16 | Ga0070685_10214538 | 3300005466 | Bacteria | 1258 |
| 17 | Ga0070665_100002641 | 3300005548 | Bacteria | 19515 |
| 18 | Ga0070665_100154077 | 3300005548 | Bacteria | 2300 |
| 19 | Ga0070665_100700085 | 3300005548 | Bacteria | 1026 |
| 20 | Ga0068852_100072416 | 3300005616 | Bacteria | 3028 |
| 21 | Ga0068864_100408892 | 3300005618 | Bacteria | 1291 |
| 22 | Ga0068861_100336135 | 3300005719 | Bacteria | 1320 |
| 23 | Ga0068870_10018213 | 3300005840 | Bacteria | 3388 |
| 24 | Ga0068863_100099227 | 3300005841 | Bacteria | 2767 |
| 25 | Ga0068860_100012559 | 3300005843 | Bacteria | 8338 |
| 26 | Ga0081539_10000162 | 3300005985 | Bacteria | 156292 |
| 27 | Ga0075365_10207972 | 3300006038 | Bacteria | 1372 |
| 28 | Ga0075364_10114889 | 3300006051 | Bacteria | 1799 |
| 29 | Ga0075364_10256103 | 3300006051 | Bacteria | 1189 |
| 30 | Ga0068871_100185443 | 3300006358 | Bacteria | 1790 |
| 31 | Ga0075428_100495010 | 3300006844 | Bacteria | 1308 |
| 32 | Ga0068865_100038780 | 3300006881 | Bacteria | 3226 |
| 33 | Ga0111539_10049634 | 3300009094 | Bacteria | 5003 |
| 34 | Ga0105245_10049489 | 3300009098 | Bacteria | 3764 |
| 35 | Ga0114129_11035923 | 3300009147 | Bacteria | 1031 |
| 36 | Ga0105248_10337052 | 3300009177 | Bacteria | 1698 |
| 37 | Ga0105249_10569691 | 3300009553 | Bacteria | 1185 |
| 38 | Ga0157375_10573889 | 3300013308 | Bacteria | 1288 |
| 39 | Ga0163163_10325292 | 3300014325 | Bacteria | 1591 |
| 40 | Ga0157377_10011913 | 3300014745 | Bacteria | 4356 |
| 41 | Ga0157379_10009265 | 3300014968 | Bacteria | 8573 |
| 42 | Ga0207688_10026954 | 3300025901 | Bacteria | 3161 |
| 43 | Ga0207643_10006659 | 3300025908 | Bacteria | 6195 |
| 44 | Ga0207687_10104412 | 3300025927 | Bacteria | 2092 |
| 45 | Ga0207644_10007059 | 3300025931 | Bacteria | 7318 |
| 46 | Ga0207704_10459551 | 3300025938 | Bacteria | 1018 |
| 47 | Ga0207691_10000938 | 3300025940 | Bacteria | 28954 |
| 48 | Ga0207711_10089311 | 3300025941 | Bacteria | 2707 |
| 49 | Ga0207661_10004427 | 3300025944 | Bacteria | 9858 |
| 50 | Ga0207661_10385880 | 3300025944 | Bacteria | 1268 |
| 51 | Ga0207679_10045521 | 3300025945 | Bacteria | 3174 |
| 52 | Ga0207668_10120882 | 3300025972 | Bacteria | 1983 |
| 53 | Ga0207677_10143778 | 3300026023 | Bacteria | 1830 |
| 54 | Ga0207678_10008050 | 3300026067 | Bacteria | 9295 |
| 55 | Ga0207708_10000683 | 3300026075 | Bacteria | 25782 |
| 56 | Ga0207641_10076379 | 3300026088 | Bacteria | 2896 |
| 57 | Ga0207648_10001487 | 3300026089 | Bacteria | 25804 |
| 58 | Ga0207676_10528554 | 3300026095 | Bacteria | 1124 |
| 59 | Ga0207675_100001224 | 3300026118 | Bacteria | 25629 |
| 60 | Ga0207698_10018087 | 3300026142 | Bacteria | 4796 |
| 61 | Ga0207428_10351258 | 3300027907 | Bacteria | 1085 |
| 62 | Ga0268266_10094556 | 3300028379 | Bacteria | 2623 |
| 63 | Ga0268266_10149331 | 3300028379 | Bacteria | 2105 |
| 64 | Ga0268266_10361025 | 3300028379 | Bacteria | 1367 |
| 65 | Ga0268265_10326226 | 3300028380 | Bacteria | 1393 |
| 66 | Ga0268264_10028730 | 3300028381 | Bacteria | 4551 |
| 67 | Ga0307513_10015972 | 3300031456 | Bacteria | 9080 |
| 68 | Ga0307408_100302296 | 3300031548 | Bacteria | 1341 |
| 69 | Ga0307514_10141533 | 3300031649 | Bacteria | 1634 |
| 70 | Ga0307413_10154717 | 3300031824 | Bacteria | 1602 |
| 71 | Ga0307410_10018676 | 3300031852 | Bacteria | 4195 |
| 72 | Ga0307410_10069822 | 3300031852 | Bacteria | 2431 |
| 73 | Ga0307406_10000648 | 3300031901 | Bacteria | 19779 |
| 74 | Ga0307406_10001084 | 3300031901 | Bacteria | 15146 |
| 75 | Ga0307406_10053231 | 3300031901 | Bacteria | 2577 |
| 76 | Ga0307406_10292585 | 3300031901 | Bacteria | 1247 |
| 77 | Ga0307406_10506487 | 3300031901 | Bacteria | 980 |
| 78 | Ga0307407_10030751 | 3300031903 | Bacteria | 2900 |
| 79 | Ga0307409_100019004 | 3300031995 | Bacteria | 4640 |
| 80 | Ga0307416_100035875 | 3300032002 | Bacteria | 3794 |
| 81 | Ga0307416_100036812 | 3300032002 | Bacteria | 3758 |
| 82 | Ga0307416_100822641 | 3300032002 | Bacteria | 1026 |
| 83 | Ga0307414_10016968 | 3300032004 | Bacteria | 4444 |
| 84 | Ga0307414_10178574 | 3300032004 | Bacteria | 1705 |
| 85 | Ga0307415_100035241 | 3300032126 | Bacteria | 3267 |
| 86 | Ga0307415_100447773 | 3300032126 | Bacteria | 1115 |
| 87 | Ga0373946_0017599 | 3300035171 | Bacteria | 2736 |
| 88 | Ga0436364_0451944 | 3300037853 | Bacteria | 3947 |
| 89 | Ga0436364_0948511 | 3300037853 | Bacteria | 1031 |
| 90 | Ga0436363_1174329 | 3300039450 | Bacteria | 2722 |
| 91 | Ga0451835_0062986 | 3300041492 | Bacteria | 1055 |
| 92 | Ga0451837_0484098 | 3300041494 | Bacteria | 1165 |
| 93 | Ga0466964_0026407 | 3300044706 | Bacteria | 2273 |
| 94 | Ga0466971_0037817 | 3300044719 | Bacteria | 2164 |
| 95 | Ga0466970_0048781 | 3300044765 | Bacteria | 2258 |
| 96 | Ga0466957_0008255 | 3300044842 | Bacteria | 5917 |
| 97 | Ga0466957_0223189 | 3300044842 | Bacteria | 1245 |
| 98 | Ga0466960_0098643 | 3300044901 | Bacteria | 1501 |
| 99 | Ga0466958_0117260 | 3300045836 | Bacteria | 1665 |
| 100 | Ga0466967_0003856 | 3300045976 | Bacteria | 9932 |
| 101 | Ga0466967_0281499 | 3300045976 | Bacteria | 1596 |
| 102 | Ga0495631_0102923 | 3300046518 | Bacteria | 1229 |
| 103 | Ga0495666_0145732 | 3300046526 | Bacteria | 1102 |
| 104 | Ga0495645_0154136 | 3300046543 | Bacteria | 1593 |
| 105 | Ga0495658_0298540 | 3300046683 | Bacteria | 1018 |
| 106 | Ga0495686_0078207 | 3300047472 | Bacteria | 2025 |
| 107 | Ga0496100_0045037 | 3300048903 | Bacteria | 2829 |
| 108 | Ga0496101_0006452 | 3300048904 | Bacteria | 7548 |
| 109 | Ga0496104_0029358 | 3300048907 | Bacteria | 5100 |
| 110 | Ga0496104_0237057 | 3300048907 | Bacteria | 1736 |
| 111 | Ga0496105_0023474 | 3300048908 | Bacteria | 5003 |
| 112 | Ga0496105_0144414 | 3300048908 | Bacteria | 1957 |
| 113 | Ga0496107_0123768 | 3300048910 | Bacteria | 1906 |
| 114 | Ga0496108_0000054 | 3300048911 | Bacteria | 125333 |
| 115 | Ga0496109_0040389 | 3300048912 | Bacteria | 4226 |
| 116 | Ga0496109_0158629 | 3300048912 | Bacteria | 2119 |
| 117 | Ga0496109_0453078 | 3300048912 | Bacteria | 1212 |
| 118 | Ga0496111_0100620 | 3300048914 | Bacteria | 2123 |
| 119 | Ga0496114_0003033 | 3300048917 | Bacteria | 12879 |
| 120 | Ga0496114_0068523 | 3300048917 | Bacteria | 2979 |
| 121 | Ga0496114_0422520 | 3300048917 | Bacteria | 1181 |
| 122 | Ga0496114_0834723 | 3300048917 | Bacteria | 801 |
| 123 | Ga0496115_0073995 | 3300048918 | Bacteria | 2766 |
| 124 | Ga0496117_0001897 | 3300048920 | Bacteria | 28066 |
| 125 | Ga0496118_0110510 | 3300048921 | Bacteria | 1825 |
| 126 | Ga0496119_0009892 | 3300048922 | Bacteria | 8099 |
| 127 | Ga0496120_0008301 | 3300048923 | Bacteria | 7573 |
| 128 | Ga0496121_0005814 | 3300048924 | Bacteria | 15638 |
| 129 | Ga0496122_0021643 | 3300048925 | Bacteria | 5747 |
| 130 | Ga0496123_0155789 | 3300048926 | Bacteria | 1225 |
| 131 | Ga0496124_0006017 | 3300048927 | Bacteria | 13376 |
| 132 | Ga0496125_0004665 | 3300048928 | Bacteria | 15628 |
| 133 | Ga0496125_0016884 | 3300048928 | Bacteria | 6988 |
| 134 | Ga0496125_0018755 | 3300048928 | Bacteria | 6557 |
| 135 | Ga0496126_0014619 | 3300048929 | Bacteria | 7926 |
| 136 | Ga0501031_0041084 | 3300049568 | Bacteria | 3020 |
| 137 | Ga0501036_0033018 | 3300049572 | Bacteria | 4376 |
| 138 | Ga0501038_0260991 | 3300049574 | Bacteria | 1369 |
| 139 | Ga0501047_0577746 | 3300049581 | Bacteria | 947 |
| 140 | Ga0501071_0015869 | 3300049587 | Bacteria | 5173 |
| 141 | Ga0501072_0088086 | 3300049588 | Bacteria | 2463 |
| 142 | Ga0501076_0048473 | 3300049592 | Bacteria | 3358 |
| 143 | Ga0501079_0148118 | 3300049741 | Bacteria | 1830 |
| 144 | Ga0501080_0450891 | 3300049742 | Bacteria | 1153 |
| 145 | Ga0501081_0034435 | 3300049743 | Bacteria | 3446 |
| 146 | Ga0501045_0120359 | 3300049824 | Bacteria | 1949 |
| 147 | nmdc:mga00v17_92165_c1 | 3300050491 | Bacteria | 1904 |
| 148 | nmdc:mga0yw44_157668_c1 | 3300050492 | Bacteria | 1484 |
| 149 | nmdc:mga08y16_220714_c1 | 3300050511 | Bacteria | 1963 |
| 150 | nmdc:mga08y16_330351_c1 | 3300050511 | Bacteria | 1568 |
| 151 | Ga0530510_0202796 | 3300061734 | Bacteria | 1474 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0422520 | Ga0496114_0422520_27_800 | 256 |
| 2 | 3300048917 | Ga0496114_0834723 | Ga0496114_0834723_15_785 | 256 |
| 3 | 3300031901 | Ga0307406_10506487 | Ga0307406_105064871 | 257 |
| 4 | 3300035171 | Ga0373946_0017599 | Ga0373946_0017599_1906_2682 | 257 |
| 5 | 3300039450 | Ga0436363_1174329 | Ga0436363_1174329_350_1180 | 257 |
| 6 | 3300046526 | Ga0495666_0145732 | Ga0495666_0145732_304_1080 | 257 |
| 7 | 3300046543 | Ga0495645_0154136 | Ga0495645_0154136_20_796 | 257 |
| 8 | 3300046683 | Ga0495658_0298540 | Ga0495658_0298540_201_977 | 257 |
| 9 | iso_pu_bacteria | 2582580736 | 2583151667 | 281 |
| 10 | iso_pu_bacteria | 2643221724 | 2644678705 | 284 |
| 11 | iso_pu_bacteria | 2728369380 | 2730228208 | 284 |
| 12 | iso_pu_bacteria | 2747842429 | 2747955326 | 284 |
| 13 | iso_pu_bacteria | 2852677369 | 2852680539 | 284 |
| 14 | iso_pu_bacteria | 2857723135 | 2857725622 | 284 |
| 15 | iso_pu_bacteria | 2862993130 | 2862995947 | 284 |
| 16 | iso_pu_bacteria | 2939660829 | 2939661264 | 284 |
| 17 | iso_pu_bacteria | 2946080515 | 2946081940 | 284 |
| 18 | 3300005347 | Ga0070668_100410419 | Ga0070668_1004104191 | 285 |
| 19 | 3300005347 | Ga0070668_100531884 | Ga0070668_1005318841 | 285 |
| 20 | 3300005355 | Ga0070671_100004519 | Ga0070671_1000045198 | 285 |
| 21 | 3300005548 | Ga0070665_100002641 | Ga0070665_10000264111 | 285 |
| 22 | 3300005841 | Ga0068863_100099227 | Ga0068863_1000992273 | 285 |
| 23 | 3300005843 | Ga0068860_100012559 | Ga0068860_1000125595 | 285 |
| 24 | 3300025931 | Ga0207644_10007059 | Ga0207644_100070596 | 285 |
| 25 | 3300026088 | Ga0207641_10076379 | Ga0207641_100763792 | 285 |
| 26 | 3300028379 | Ga0268266_10094556 | Ga0268266_100945562 | 285 |
| 27 | 3300028381 | Ga0268264_10028730 | Ga0268264_100287302 | 285 |
| 28 | 3300031548 | Ga0307408_100302296 | Ga0307408_1003022962 | 285 |
| 29 | 3300031901 | Ga0307406_10292585 | Ga0307406_102925851 | 285 |
| 30 | 3300032002 | Ga0307416_100035875 | Ga0307416_1000358753 | 285 |
| 31 | 3300044842 | Ga0466957_0223189 | Ga0466957_0223189_223_1080 | 285 |
| 32 | 3300048911 | Ga0496108_0000054 | Ga0496108_0000054_100209_101072 | 286 |
| 33 | iso_pu_bacteria | 2818991462 | 2819691571 | 286 |
| 34 | 3300005347 | Ga0070668_100396199 | Ga0070668_1003961991 | 287 |
| 35 | 3300005455 | Ga0070663_100000772 | Ga0070663_1000007722 | 287 |
| 36 | 3300005548 | Ga0070665_100700085 | Ga0070665_1007000851 | 287 |
| 37 | 3300006051 | Ga0075364_10114889 | Ga0075364_101148892 | 287 |
| 38 | 3300014968 | Ga0157379_10009265 | Ga0157379_100092654 | 287 |
| 39 | 3300025972 | Ga0207668_10120882 | Ga0207668_101208822 | 287 |
| 40 | 3300026067 | Ga0207678_10008050 | Ga0207678_100080503 | 287 |
| 41 | 3300028379 | Ga0268266_10361025 | Ga0268266_103610251 | 287 |
| 42 | 3300031456 | Ga0307513_10015972 | Ga0307513_100159728 | 287 |
| 43 | 3300044765 | Ga0466970_0048781 | Ga0466970_0048781_313_1176 | 287 |
| 44 | 3300044901 | Ga0466960_0098643 | Ga0466960_0098643_173_1036 | 287 |
| 45 | 3300045976 | Ga0466967_0281499 | Ga0466967_0281499_395_1258 | 287 |
| 46 | 3300048903 | Ga0496100_0045037 | Ga0496100_0045037_321_1187 | 287 |
| 47 | 3300048904 | Ga0496101_0006452 | Ga0496101_0006452_5314_6180 | 287 |
| 48 | 3300048907 | Ga0496104_0029358 | Ga0496104_0029358_1345_2211 | 287 |
| 49 | 3300048908 | Ga0496105_0023474 | Ga0496105_0023474_780_1646 | 287 |
| 50 | 3300048912 | Ga0496109_0158629 | Ga0496109_0158629_54_920 | 287 |
| 51 | 3300048914 | Ga0496111_0100620 | Ga0496111_0100620_1179_2045 | 287 |
| 52 | 3300048922 | Ga0496119_0009892 | Ga0496119_0009892_4746_5612 | 287 |
| 53 | 3300048923 | Ga0496120_0008301 | Ga0496120_0008301_5195_6061 | 287 |
| 54 | 3300048924 | Ga0496121_0005814 | Ga0496121_0005814_2762_3628 | 287 |
| 55 | 3300048927 | Ga0496124_0006017 | Ga0496124_0006017_1269_2135 | 287 |
| 56 | 3300048928 | Ga0496125_0016884 | Ga0496125_0016884_4603_5469 | 287 |
| 57 | 3300049581 | Ga0501047_0577746 | Ga0501047_0577746_63_926 | 287 |
| 58 | iso_pu_bacteria | 2772190715 | 2772642998 | 287 |
| 59 | iso_pu_bacteria | 2855670206 | 2855673026 | 287 |
| 60 | iso_pu_bacteria | 2857288857 | 2857293783 | 287 |
| 61 | iso_pu_bacteria | 2858882152 | 2858884407 | 287 |
| 62 | iso_pu_bacteria | 2858895516 | 2858896797 | 287 |
| 63 | iso_pu_bacteria | 2869061728 | 2869063002 | 287 |
| 64 | iso_pu_bacteria | 2869068681 | 2869069169 | 287 |
| 65 | iso_pu_bacteria | 2880489317 | 2880491862 | 287 |
| 66 | iso_pu_bacteria | 2880495981 | 2880500439 | 287 |
| 67 | iso_pu_bacteria | 2929226422 | 2929228949 | 287 |
| 68 | iso_pu_bacteria | 8003830390 | 8003831106 | 287 |
| 69 | iso_pu_bacteria | 8003870546 | 8003873767 | 287 |
| 70 | 3300005288 | Ga0065714_10071451 | Ga0065714_100714512 | 288 |
| 71 | 3300005548 | Ga0070665_100154077 | Ga0070665_1001540772 | 288 |
| 72 | 3300006038 | Ga0075365_10207972 | Ga0075365_102079721 | 288 |
| 73 | 3300006051 | Ga0075364_10256103 | Ga0075364_102561031 | 288 |
| 74 | 3300006844 | Ga0075428_100495010 | Ga0075428_1004950102 | 288 |
| 75 | 3300009094 | Ga0111539_10049634 | Ga0111539_100496342 | 288 |
| 76 | 3300013308 | Ga0157375_10573889 | Ga0157375_105738892 | 288 |
| 77 | 3300027907 | Ga0207428_10351258 | Ga0207428_103512582 | 288 |
| 78 | 3300028379 | Ga0268266_10149331 | Ga0268266_101493313 | 288 |
| 79 | 3300031901 | Ga0307406_10000648 | Ga0307406_100006485 | 288 |
| 80 | 3300031901 | Ga0307406_10001084 | Ga0307406_1000108410 | 288 |
| 81 | 3300037853 | Ga0436364_0451944 | Ga0436364_0451944_1696_2562 | 288 |
| 82 | 3300041494 | Ga0451837_0484098 | Ga0451837_0484098_281_1147 | 288 |
| 83 | 3300046518 | Ga0495631_0102923 | Ga0495631_0102923_230_1096 | 288 |
| 84 | 3300047472 | Ga0495686_0078207 | Ga0495686_0078207_78_944 | 288 |
| 85 | 3300048920 | Ga0496117_0001897 | Ga0496117_0001897_21724_22590 | 288 |
| 86 | 3300048921 | Ga0496118_0110510 | Ga0496118_0110510_864_1730 | 288 |
| 87 | 3300048928 | Ga0496125_0018755 | Ga0496125_0018755_4667_5533 | 288 |
| 88 | 3300048929 | Ga0496126_0014619 | Ga0496126_0014619_2131_2997 | 288 |
| 89 | 3300050491 | nmdc:mga00v17_92165_c1 | nmdc:mga00v17_92165_c1_202_1068 | 288 |
| 90 | 3300050492 | nmdc:mga0yw44_157668_c1 | nmdc:mga0yw44_157668_c1_286_1152 | 288 |
| 91 | 3300050511 | nmdc:mga08y16_220714_c1 | nmdc:mga08y16_220714_c1_844_1710 | 288 |
| 92 | 3300050511 | nmdc:mga08y16_330351_c1 | nmdc:mga08y16_330351_c1_570_1436 | 288 |
| 93 | 3300005329 | Ga0070683_100142739 | Ga0070683_1001427392 | 289 |
| 94 | 3300005337 | Ga0070682_100031688 | Ga0070682_1000316882 | 289 |
| 95 | 3300005343 | Ga0070687_100208625 | Ga0070687_1002086252 | 289 |
| 96 | 3300005345 | Ga0070692_10046740 | Ga0070692_100467403 | 289 |
| 97 | 3300005347 | Ga0070668_100001845 | Ga0070668_10000184510 | 289 |
| 98 | 3300005441 | Ga0070700_100002817 | Ga0070700_1000028179 | 289 |
| 99 | 3300005459 | Ga0068867_100042558 | Ga0068867_1000425582 | 289 |
| 100 | 3300005466 | Ga0070685_10214538 | Ga0070685_102145381 | 289 |
| 101 | 3300005616 | Ga0068852_100072416 | Ga0068852_1000724161 | 289 |
| 102 | 3300005618 | Ga0068864_100408892 | Ga0068864_1004088921 | 289 |
| 103 | 3300005719 | Ga0068861_100336135 | Ga0068861_1003361352 | 289 |
| 104 | 3300005840 | Ga0068870_10018213 | Ga0068870_100182134 | 289 |
| 105 | 3300006358 | Ga0068871_100185443 | Ga0068871_1001854432 | 289 |
| 106 | 3300006881 | Ga0068865_100038780 | Ga0068865_1000387802 | 289 |
| 107 | 3300009098 | Ga0105245_10049489 | Ga0105245_100494892 | 289 |
| 108 | 3300009147 | Ga0114129_11035923 | Ga0114129_110359232 | 289 |
| 109 | 3300009177 | Ga0105248_10337052 | Ga0105248_103370522 | 289 |
| 110 | 3300009553 | Ga0105249_10569691 | Ga0105249_105696911 | 289 |
| 111 | 3300014325 | Ga0163163_10325292 | Ga0163163_103252922 | 289 |
| 112 | 3300014745 | Ga0157377_10011913 | Ga0157377_100119134 | 289 |
| 113 | 3300025901 | Ga0207688_10026954 | Ga0207688_100269543 | 289 |
| 114 | 3300025908 | Ga0207643_10006659 | Ga0207643_100066593 | 289 |
| 115 | 3300025927 | Ga0207687_10104412 | Ga0207687_101044122 | 289 |
| 116 | 3300025938 | Ga0207704_10459551 | Ga0207704_104595511 | 289 |
| 117 | 3300025940 | Ga0207691_10000938 | Ga0207691_1000093825 | 289 |
| 118 | 3300025941 | Ga0207711_10089311 | Ga0207711_100893112 | 289 |
| 119 | 3300025944 | Ga0207661_10385880 | Ga0207661_103858802 | 289 |
| 120 | 3300026023 | Ga0207677_10143778 | Ga0207677_101437782 | 289 |
| 121 | 3300026075 | Ga0207708_10000683 | Ga0207708_1000068324 | 289 |
| 122 | 3300026089 | Ga0207648_10001487 | Ga0207648_1000148727 | 289 |
| 123 | 3300026118 | Ga0207675_100001224 | Ga0207675_10000122422 | 289 |
| 124 | 3300026142 | Ga0207698_10018087 | Ga0207698_100180874 | 289 |
| 125 | 3300028380 | Ga0268265_10326226 | Ga0268265_103262262 | 289 |
| 126 | 3300031852 | Ga0307410_10018676 | Ga0307410_100186762 | 289 |
| 127 | 3300031901 | Ga0307406_10053231 | Ga0307406_100532312 | 289 |
| 128 | 3300032002 | Ga0307416_100822641 | Ga0307416_1008226411 | 289 |
| 129 | 3300032004 | Ga0307414_10178574 | Ga0307414_101785742 | 289 |
| 130 | 3300032126 | Ga0307415_100447773 | Ga0307415_1004477732 | 289 |
| 131 | 3300037853 | Ga0436364_0948511 | Ga0436364_0948511_138_1010 | 289 |
| 132 | 3300041492 | Ga0451835_0062986 | Ga0451835_0062986_27_902 | 289 |
| 133 | 3300044706 | Ga0466964_0026407 | Ga0466964_0026407_59_928 | 289 |
| 134 | 3300044719 | Ga0466971_0037817 | Ga0466971_0037817_555_1427 | 289 |
| 135 | 3300044842 | Ga0466957_0008255 | Ga0466957_0008255_115_987 | 289 |
| 136 | 3300045836 | Ga0466958_0117260 | Ga0466958_0117260_156_1028 | 289 |
| 137 | 3300045976 | Ga0466967_0003856 | Ga0466967_0003856_5918_6787 | 289 |
| 138 | 3300048910 | Ga0496107_0123768 | Ga0496107_0123768_110_985 | 289 |
| 139 | 3300048912 | Ga0496109_0040389 | Ga0496109_0040389_3167_4042 | 289 |
| 140 | 3300049568 | Ga0501031_0041084 | Ga0501031_0041084_1289_2158 | 289 |
| 141 | 3300049572 | Ga0501036_0033018 | Ga0501036_0033018_2638_3507 | 289 |
| 142 | 3300049574 | Ga0501038_0260991 | Ga0501038_0260991_267_1136 | 289 |
| 143 | 3300049587 | Ga0501071_0015869 | Ga0501071_0015869_1227_2096 | 289 |
| 144 | 3300049588 | Ga0501072_0088086 | Ga0501072_0088086_757_1626 | 289 |
| 145 | 3300049592 | Ga0501076_0048473 | Ga0501076_0048473_1691_2560 | 289 |
| 146 | 3300049741 | Ga0501079_0148118 | Ga0501079_0148118_748_1617 | 289 |
| 147 | 3300049742 | Ga0501080_0450891 | Ga0501080_0450891_27_896 | 289 |
| 148 | 3300049743 | Ga0501081_0034435 | Ga0501081_0034435_2117_2986 | 289 |
| 149 | 3300049824 | Ga0501045_0120359 | Ga0501045_0120359_644_1513 | 289 |
| 150 | 3300061734 | Ga0530510_0202796 | Ga0530510_0202796_553_1422 | 289 |
| 151 | iso_pu_bacteria | 2622736605 | 2623502049 | 289 |
| 152 | 3300048912 | Ga0496109_0453078 | Ga0496109_0453078_182_1054 | 290 |
| 153 | 3300048917 | Ga0496114_0068523 | Ga0496114_0068523_143_1021 | 290 |
| 154 | 3300048918 | Ga0496115_0073995 | Ga0496115_0073995_461_1336 | 290 |
| 155 | 3300005329 | Ga0070683_100005614 | Ga0070683_1000056145 | 291 |
| 156 | 3300025944 | Ga0207661_10004427 | Ga0207661_100044276 | 291 |
| 157 | 3300025945 | Ga0207679_10045521 | Ga0207679_100455212 | 291 |
| 158 | 3300031649 | Ga0307514_10141533 | Ga0307514_101415332 | 291 |
| 159 | 3300031824 | Ga0307413_10154717 | Ga0307413_101547172 | 291 |
| 160 | 3300031852 | Ga0307410_10069822 | Ga0307410_100698223 | 291 |
| 161 | 3300031903 | Ga0307407_10030751 | Ga0307407_100307513 | 291 |
| 162 | 3300031995 | Ga0307409_100019004 | Ga0307409_1000190045 | 291 |
| 163 | 3300032002 | Ga0307416_100036812 | Ga0307416_1000368123 | 291 |
| 164 | 3300032004 | Ga0307414_10016968 | Ga0307414_100169682 | 291 |
| 165 | 3300032126 | Ga0307415_100035241 | Ga0307415_1000352413 | 291 |
| 166 | 3300048907 | Ga0496104_0237057 | Ga0496104_0237057_107_997 | 291 |
| 167 | 3300048908 | Ga0496105_0144414 | Ga0496105_0144414_487_1377 | 291 |
| 168 | 3300048917 | Ga0496114_0003033 | Ga0496114_0003033_9098_9988 | 291 |
| 169 | 3300003203 | JGI25406J46586_10008679 | JGI25406J46586_100086793 | 292 |
| 170 | 3300005985 | Ga0081539_10000162 | Ga0081539_10000162103 | 292 |
| 171 | 3300026095 | Ga0207676_10528554 | Ga0207676_105285541 | 292 |
| 172 | 3300048925 | Ga0496122_0021643 | Ga0496122_0021643_738_1703 | 292 |
| 173 | 3300048926 | Ga0496123_0155789 | Ga0496123_0155789_132_1097 | 292 |
| 174 | 3300048928 | Ga0496125_0004665 | Ga0496125_0004665_3390_4355 | 292 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xmd-assembly2.cif.gz_B | crystal structure of epoxide hydrolase vreh1 from vigna radiata | 0.8675 | 5 | 128 |
| 6ty7-assembly1.cif.gz_A | crystal structure of haloalkane dehalogenase variant dhaa115 domain-swapped dimer type-1 | 0.8343 | 6 | 125 |
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8324 | 6 | 125 |
| 6xtc-assembly2.cif.gz_D | crystal structure of haloalkane dehalogenase variant dhaa177 domain-swapped dimer type-3 | 0.8319 | 6 | 125 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8286 | 6 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IK35_1_258_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9025 | 84 | 126 | 3.40.50.1820 |
| af_Q9D379_48_454_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8641 | 4 | 126 | 3.40.50.1820 |
| af_Q9NQF3_11_190_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8607 | 6 | 122 | 3.40.50.1820 |
| af_Q4CQ94_14_186_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8516 | 15 | 125 | 3.40.50.12270 |
| af_Q54CU1_1_267_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8512 | 19 | 122 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0CWU2-F1-model_v4 | Alpha/beta hydrolase | 0.9895 | 110 | 292 |
|
| AF-K0ENF1-F1-model_v4 | Hydrolase | 0.9892 | 6 | 291 |
GO:0016787
|
| AF-A0A845J666-F1-model_v4 | Alpha/beta fold hydrolase | 0.9862 | 36 | 289 |
GO:0016020
GO:0016787 |
| AF-K0ENF1-F1-model_v4 | Hydrolase | 0.9823 | 6 | 291 |
GO:0016787
|
| AF-A0A7K0CWU2-F1-model_v4 | Alpha/beta hydrolase | 0.9789 | 110 | 292 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar